The URL can be used to link to this page

Home My WebLink About2025/02/03 - ADMIN - Agenda Packets - City Council - RegularAGENDA FEBRUARY 3, 2025 6:00 p.m. Economic Development Authority meeting – Council Chambers 1. Call to order a.Roll call. 2. Approve agenda. 3. Minutes – none. 4.Consent items a.Approve EDA disbursements 5. Public hearings – none. 6. Regular business – none. 7. Communications and announcements – none. 8. Adjournment. 6:15 p.m. City council meeting – Council Chambers 1.Call to order a.Roll call. b.Pledge of Allegiance. 2.Approve agenda. 3.Presentations a.Proclamation observing Black History Month 4.Minutes a.Minutes of January 6, 2025 city council study session 5.Consent items a.Approve city disbursements b.Resolution approving liquor license renewals c.Approve bid for removal of nuisance trees on public property for 2025 - 2026 d.Approve bid for removal of nuisance trees on private property for 2025 - 2026 e.Approve replacement of zamboni (unit 1108) f.Approve replacement of Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V-plow (units 1924, 1924B and 1924P) g.Resolution authorizing special assessment for water service line repair at 5922 Excelsior Boulevard - Ward 2 Agenda EDA, city council and study session meetings of February 3, 2025 6.Public hearings a.Public hearing for on-sale cocktail room and off-sale microdistillery liquor licenses b.Public hearing on establishment of the Terasă TIF District - Ward 4 7.Regular business a.Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 b.Resolution establishing the 2025 Pavement Management project (4025-1000) - Ward 4 c.Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) - Ward 2 d.Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) - Ward 4 8.Communications and announcements – none. 9.Adjournment. Following city council meeting – Special study session – Community Room Discussion item 1. Boards and commissions protocol setting meeting Written reports 2. Community Development Block Grant 2025 3. Proposed amendments to city code chapters 8 and 18 related to tobacco licensing and definitions of drug paraphernalia 4. Cannabis and lower-potency hemp retail registration Members of the public can attend St. Louis Park Economic Development Authority and city council meetings in person. At regular city council meetings, members of the public may comment on any item on the agenda by attending the meeting in-person or by submitting written comments to info@stlouisparkmn.gov by noon the day of the meeting. Official minutes of meetings are available on the city website once approved. Watch St. Louis Park Economic Development Authority or regular city council meetings live at bit.ly/watchslpcouncil or at www.parktv.org, or on local cable (Comcast SD channel 14/HD channel 798). Recordings of the meetings are available to watch on the city's YouTube channel at www.youtube.com/@slpcable, usually within 24 hours of the meeting’s end. City council study sessions are not broadcast. Generally, it is not council practice to receive public comment during study sessions. The council chambers are equipped with Hearing Loop equipment and headsets are available to borrow. If you need special accommodations or have questions about the meeting, please call 952.924.2505. Meeting: Economic development authority Meeting date: February 3, 2025 Consent agenda item: 4a Executive summary Title: Approve EDA disbursements Recommended action: Motion to approve EDA disbursement claims for the period of Dec. 21, 2024 – Jan. 20, 2025 Policy consideration: Does the EDA approve the disbursements for the period ending Jan. 20, 2025? Summary: The finance department prepares this report monthly for the EDA to review and approve. The attached report shows both EDA disbursements paid by physical check and those by wire transfer or Automated Clearing House (ACH) when applicable. Financial or budget considerations: Review and approval of disbursements by the EDA is required and provides another layer of oversight to further ensure fiscal stewardship. Strategic priority consideration: Not applicable. Supporting documents: EDA disbursement summary Prepared by: Estela Mulugeta, accounting specialist Reviewed by: Amelia Cruver, finance director Approved by: Kim Keller, city manager CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 572.45CENTERPOINT ENERGY EDA - 4300 36 1/2 G&A Heating Gas Utility 572.45 940.00CUSTOM PRODUCTS & SERVICES Development - EDA G&A Repairs and Maintenance 940.00 232.50EHLERS & ASSOCIATES INC Texa Tonka TIF G&A Consulting Fees/Fees For Serv 232.50Parkway Residual TIF G&A Consulting Fees/Fees For Serv 232.50Bridgewater Bank TIF G&A Consulting Fees/Fees For Serv 232.50Wooddale Station TIF G&A Consulting Fees/Fees For Serv 232.50Elmwood Apartments TIF G&A Consulting Fees/Fees For Serv 232.504900 Excelsior Blvd TIF G&A Consulting Fees/Fees For Serv 232.50Eliot Park TIF G&A Consulting Fees/Fees For Serv 232.50Duke West End TIF G&A Consulting Fees/Fees For Serv 232.50Ellipse TIF G&A Consulting Fees/Fees For Serv 232.50Victoria Ponds TIF G&A Consulting Fees/Fees For Serv 232.50Park Center Housing TIF G&A Consulting Fees/Fees For Serv 232.50CSM TIF G&A Consulting Fees/Fees For Serv 232.50Mill City TIF G&A Consulting Fees/Fees For Serv 232.50Park Commons TIF G&A Consulting Fees/Fees For Serv 232.50Wolfe Lake TIF G&A Consulting Fees/Fees For Serv 232.50Shoram TIF G&A Consulting Fees/Fees For Serv 232.50Aquila Commons TIF G&A Consulting Fees/Fees For Serv 232.50Rise on 7 TIF G&A Consulting Fees/Fees For Serv 232.50Hwy 7 Business Center TIF G&A Consulting Fees/Fees For Serv 4,417.50 213.01XCEL ENERGY EDA - 4300 36 1/2 G&A Electric Utility 213.01 Report Totals 6,142.96 Economic Development Authority meeting of February 3, 2025 (Item No. 4a) Title: Approve EDA disbursements Page 2 Meeting: City council Meeting date: February 2, 2025 Presentation: 3a Executive summary Title: Proclamation observing Black History Month Recommended action: The mayor is asked to read and present the proclamation. Policy consideration: None. Summary: Black History Month is observed annually in the United States in February to officially recognize and honor the history, leadership and countless contributions of Black people in the United States and across the world. This celebration started from a “Negro History Week” celebration in 1926 and spread across schools, then college campuses, and grew into a month-long observance that became federally recognized in 1976. Black History Month continues to be one of the most important cultural heritage months in the U.S. Financial or budget considerations: None. Strategic priority consideration: St. Louis Park is committed to being a leader in racial equity and inclusion in order to create a more just and inclusive community for all. Supporting documents: Resource page Proclamation Prepared by: Jocelyn I Hernandez Guitron, racial equity and inclusion specialist BIPOC Employee Resource Group Reviewed by: Cheyenne Brodeen, administrative services director Approved by: Kim Keller, city manager City council meeting of February 2, 2025 (Item No. 3a) Page 2 Title: Proclamation observing Black History Month Resource page In observance of Black History Month, the City of St. Louis Park invites you to:  • Learn about Black history in the United States o North Star: A Digital Journey of African American History | National Museum of African American History and Culture • Explore local events in honor of Black History Month o Celebrate Black History Month in Minneapolis | Meet Minneapolis | Meet Minneapolis o Black History Month events in the Twin Cities: Feb. 1-8 | Minnesota Spokesman- Recorder City council meeting of February 2, 2025 (Item No. 3a) Page 3 Title: Proclamation observing Black History Month Proclamation “Black History Month” Whereas, Black History Month started as a way to gain rightful recognition for the significant importance Black people hold in American history; and Whereas, Black Americans have made countless contributions to the nation’s culture, politics, workforce, arts and legacy that have too often been overlooked and undermined; and Whereas, This history includes the challenging and dangerous work led by Black people in the advancement of civil rights which ensured protections from discrimination based on a person’s skin color: rights that we continue to defend today; and Whereas, The City of St. Louis Park values these rights and continues to be committed to work that results in racial equity and inclusion; and Whereas, St. Louis Park residents, businesses and visitors are encouraged to learn about the continued legacy of Black History Month Now therefore, let it be known that the mayor and city council of the City of St. Louis Park, Minnesota, hereby proclaim February 2025, as Black History Month in our community. Wherefore, I set my hand and cause the Great Seal of the City of St. Louis Park to be affixed this 3rd of February 2025. _________________________________ Nadia Mohamed, mayor Meeting: City council Meeting date: February 3, 2025 Minutes: 4a Unofficial minutes City council study session St. Louis Park, Minnesota Jan. 6, 2025 Mayor Mohamed called the meeting to order at 6:46 p.m. Council members present: Mayor Nadia Mohamed, Paul Baudhuin, Tim Brausen, Sue Budd, Yolanda Farris, Lynette Dumalag, and Margaret Rog Council members absent: none Staff present: City manager (Ms. Keller), planning manager (Mr. Walther), administrative services director (Ms. Brodeen), community engagement coordinator (Mr. Coleman) Guest: Jen Krava, Forecast Public Art Discussion item 1. Vision 4.0 engagement plan Mr. Coleman introduced Jen Krava from Forecast Public Art to present the staff report. Council Member Baudhuin asked what strategies are planned to reach and engage certain communities, such as renters. Ms. Krava stated the community committee will be an important part of the engagement. Forecast Public Art will use the committee’s networks of trusted people who can also engage with various groups within the community. Council Member Rog asked about concerns around the high focus on the arts and the organizations, and how those concerns will be addressed in the engagement process. Ms. Krava stated the questions will not likely be about art; questions will be around housing and mobility. She noted art is a way to bring people in if they are intimidated by process. The ambassador cohort conversations will focus on broader topics, larger issues and aspirations. Council Member Rog stated some will not be able to engage with the arts. Ms. Krava added that multiple strategies, such as town hall events, will also be utilized for broader engagement. Council Member Rog noted past Vision reports and said the statements from the first Vision were the most powerful. She described them as having had more detail while feeling more personal. She gave examples of statements regarding children and diversity, environmental stewardship leaders and community engagement. She suggested the ambassador cohort group might consider all the different ways Visions can be articulated to the community, instead of looking to previous models. Mr. Walther stated the emphasis from the first process was likely influenced by who was participating. It had leaned on input from the city council, commissions and city government. In City council meeting of February 3, 2025 (Item No. 4a) Page 2 Title: City council study session meeting minutes of January 6, 2025 turn, that led to a focus on things the city works on. He noted the first Vision process also had the fewest participants. Council Member Rog stated concerns about the success of past facilitated conversations, as attendance and participation can be challenging. She asked if there is a stipend to include treats. Ms. Krava stated this all comes down to making sure the Visioning process connects with all types of people by spreading the word through the community committee. They will work on how to reach people and gain their input and participation, even if residents do not physically attend. She stated there may be challenges, but noted her team is nimble and flexible in their work to reach and engage residents. Council Member Rog stated she will email her suggestions about engagement to city staff. Council Member Rog stated neighborhood organizations need to be included; they are ready- made for and want to be asked to do this work. Council Member Dumalag stated she was part of Vision 3.0 and noted the facilitated sessions at city hall were very different from the pop-ups and home tours. She asked that facilitators be mindful of schedules and work to attract people to attend sessions who typically would not participate. She pointed out that Discover St. Louis Park is now called Westopolis. Council Member Dumalag asked about the benchmarking process and what occurred. Ms. Krava stated they have looked over the past Vision sessions and will continue to do so. Council Member Dumalag noted the training for facilitators to host community conversations had the most diverse representations and reveals comments from people of color who felt isolated and not part of St. Louis Park. She is interested in how we are now doing as a community. Ms. Krava stated she is not sure this is in the project’s scope, but that they will look at this. Council Member Brausen stated after Vision 3.0, the council spent significant time discussing the outcomes and then developing their strategic goals. Since then, their policy decisions have been tied into strategic goals as much as possible. Mr. Walther stated that Vision 4.0 will generate a recommendations list that will provide the context for later strategic planning direction, similar to last time. Council Member Brausen stated he will send a list of recommendations to staff as well. He noted that bars and restaurants also have their own communities. Affordable housing communities need to be reached out to; the city has relationships with people that live there, adding this contact will be important. He suggested all faith-based organizations in the city be invited to participate as well. Council Member Budd asked if outreach would target affordable housing apartments as places to have smaller group discussions. Ms. Krava stated they can, and they will look at who is signing up. She added they may consider conducting town halls in affordable housing developments as well. City council meeting of February 3, 2025 (Item No. 4a) Page 3 Title: City council study session meeting minutes of January 6, 2025 Council Member Budd asked if the facilitator role is served by volunteers and how they are chosen. Ms. Krava stated that people who are interested would attend training sessions. The invite to attend trainings would be broad; both wide and specific. Council Member Budd asked how many facilitators are needed. Ms. Krava stated they do not know yet and asked for recommendations. Council Member Budd stated that 70 facilitators were utilized in the past and they should represent a cross-section of residents. She added a session will also provide more value than a survey. Council Member Budd asked if there is an aversion to including boards and commissions in this process. Mr. Walther stated this is not the case; about 50 people will comprise the ambassador cohort and there were multiple ways they could be included. Council Member Brausen added that it makes sense to personally invite boards and commission members to this process. Council Member Budd stated invites should be extended to the city’s SOAR groups. She suggested outreach to the watershed districts and community early childhood education groups as well. Mayor Mohamed stated she has been working to get this message out to folks for a while. She asked what council member roles would be in this process and asked for recommendations where can council uplift this process. Ms. Krava stated that the ambassador cohort is a great place to start. They will do another update with the council and bring forward recommendations at the end of the process as well. Council members can attend the pop-up events, and they should feel welcome to attend and participate. Council Member Farris stated this process is exciting. She noted her community was not invited in the past, and stressed she and her community would like to be a part of the process this time. She asked if everyone can be involved and engaged. Ms. Krava stated yes, the visioning process is for everyone, and they will make sure there is a materials kit and business cards that can be passed out to everyone in the community. Council Member Rog asked when the website will be available. Ms. Krava stated they do not have a specific date for March 2025, but most likely it will coincide with the invite for the ambassador cohort. The website will reflect ongoing updates as more details are available. Council Member Rog stated that the more information people can receive at the beginning, the more likely they are to be engaged. She communicates with her ward members using a monthly newsletter and will spread the word on the visioning process. Council Member Rog asked if there will be stipends. Ms. Brodeen stated there will be no stipends for participants. Council Member Brausen stated this plan looks good and he is supportive of it. City council meeting of February 3, 2025 (Item No. 4a) Page 4 Title: City council study session meeting minutes of January 6, 2025 Council Member Baudhuin added events and engagement opportunities will continue to evolve. Word of mouth is very effective and sharing social media posts is another method of outreach. When events come up that should be promoted, it would be helpful to send information to the council so each member can promote it within their networks. Written Reports 2. Community Engagement system kick-off 3. 2025 Pavement Management Project update (4025-1000) – Ward 4 4. 2025 Commercial Street Rehab Project update (4025-1050) – Ward 2 Council Member Dumalag noted in the 2025 Commercial Street Rehab Project update report, an open house had been attended by only three (3) people. She stated there was good engagement for this project, leading to low turnout. This project will affect the location of the US Postal Service, and she asked city staff to communicate with their staff regarding where employees may park, enter and exit. Council Member Budd stated she will be touring the 2025 commercial rehab project with Ms. Heiser, engineering director. Council Member Brausen noted that the 2025 pavement management project reflects the exclusion of all proposed sidewalks because the loss of trees would have been catastrophic. Now, the project proposes for only one tree to be cut down. He thanked staff for updates and proactive emails regarding this update. Council Member Rog noted the community engagement system kick-off report and stated she is concerned about funding, as she is not sure what is going to be proposed. Ms. Keller stated the council gave staff a broad, high-level overview of community engagement funding in 2024 and staff will come back to the council with additional funding information. Council Member Rog stated folks will need wider notice for community engagement meetings. Communications/meeting check-in (verbal) The meeting adjourned at 7:47 p.m. ______________________________________ ______________________________________ Melissa Kennedy, city clerk Nadia Mohamed, mayor Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5a Executive summary Title: Approve city disbursements Recommended action: Motion to approve city disbursement claims for the period of Dec. 21, 2024 – Jan. 20, 2025. Policy consideration: Does the city council approve city disbursements for the period ending Jan. 20, 2025? Summary: The finance department prepares this report monthly for the city council to review and approve. The attached report shows both city disbursements paid by physical check and those by wire transfer or Automated Clearing House (ACH) when applicable. Financial or budget considerations: Review and approval of the information by council is required by the city charter and provides another layer of oversight to further ensure fiscal stewardship. Strategic priority consideration: Not applicable. Supporting documents: Disbursement summary Prepared by: Estela Mulugeta, accounting specialist Reviewed by: Amelia Cruver, finance director Approved by: Kim Keller, city manager CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 78.73 BAUDHUIN PAUL Adminstrative Operations G&A Out-of-State Travel 78.73 405.003RD LAIR Organized Rec G&A Consulting Fees/Fees For Serv 405.00 13.99A-1 OUTDOOR POWER INC General Fund BS Inventory 13.99 3,500.00AAA MINNEAPOLIS Climate Investment G&A 3,500.00 28.48ABERNATHY, LISA Organized Rec G&A Employee Mileage Reimbursement 28.48 1,278.66ADVANCED ENG & ENVIRONMENTAL SRVCS Water G&A Consulting Fees/Fees For Serv 424.67Sewer G&A Consulting Fees/Fees For Serv 424.67Storm Water Utility G&A Consulting Fees/Fees For Serv 2,128.00 55.50ADVANCED GRAPHIX INC General Fund BS Inventory 55.50 708.14ALL CITY ELEVATOR INC Facilties Maintenance G&A Consulting Fees/Fees For Serv 708.14 612.00ALLEGION ACCESS TECH LLC Rec Center Gen Division G&A Consulting Fees/Fees For Serv 612.00 740.00ALLIANT INC.Engineering G&A Consulting Fees/Fees For Serv 740.00 8,412.17ALLSTREAMIT G&A Telephone Communications 8,412.17 50.47AMAZON CAPITAL SERVICES REI G&A Admin/Office Supplies & Mat 234.00Human Resources G&A Admin/Office Supplies & Mat 355.43IT G&A Technology Supplies 79.99Community Development G&A Admin/Office Supplies & Mat 115.00Facilties Maintenance G&A Admin/Office Supplies & Mat 793.57Facilties Maintenance G&A Operations Supplies & Mat City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 2 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 192.24Police G&A Admin/Office Supplies & Mat 131.91Police G&A Operations Supplies & Mat 35.75Police G&A OTHER CONTRACTUAL SERVICES 18.95Fire Department G&A Admin/Office Supplies & Mat 443.01Fire Department G&A Operations Supplies & Mat 33.95Public Works G&A Admin/Office Supplies & Mat 627.99-Municipal Building & Infra G&A Refunds/Reimbursements 5,978.97Municipal Building & Infra G&A Admin/Office Supplies & Mat 60.96Municipal Building & Infra G&A Operations Supplies & Mat 627.99Municipal Building & Infra G&A Other Supplies & Materials 92.97Organized Rec G&A Admin/Office Supplies & Mat 19.98Organized Rec G&A Operations Supplies & Mat 24.42Park Maintenance G&A Admin/Office Supplies & Mat 99.92Park Maintenance G&A Operations Supplies & Mat 203.94Rec Center Gen Division G&A Admin/Office Supplies & Mat 903.13Rec Center Gen Division G&A Operations Supplies & Mat 208.53Vehicle Maintenance G&A Admin/Office Supplies & Mat 10,077.09 1,034.20AMBIASOLARBuilding and Energy G&A Construction Permits 1,034.20 3,200.00AMKA GLOBAL Water G&A 3,200.00 556.00ANCOM COMMUNICATIONS Police E-911 Restriction G&A Technology Supplies 556.00 30.00APPLEBEE'S NEIGHBORHOOD GRILL & BAR Adminstrative Operations G&A Licenses 30.00 24.25ARATA JEN Solid Waste G&A Employee Mileage Reimbursement 24.25 381.32ARC DOCUMENT SOLUTIONS, LLC IT G&A Short Term Lease/Rentals Pay 381.32 445.00ASCAPOrganized Rec G&A Consulting Fees/Fees For Serv 445.00 1,760.70ASPEN MILLS Fire Department G&A Operations Supplies & Mat City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 3 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 1,760.70 400.00ASSOCIATION OF MINNESOTA BUILDING Building and Energy G&A Other Travel, Conv & Conf 400.00 43.44AUTOZONE STORES LLC General Fund BS Inventory 43.44 26,827.00BASSETT CREEK WMC Storm Water Utility G&A Consulting Fees/Fees For Serv 26,827.00 4,880.00BATISTICH HEIDI Employee Benefits G&A Consulting Fees/Fees For Serv 4,880.00 3.89BATTERIES PLUS BULBS Facilties Maintenance G&A Operations Supplies & Mat 3.89 22,772.75BEAUDRY OIL & PROPANE General Fund BS Inventory 22,772.75 301.53BEAUVAIS BEAUX Fire Department G&A Out-of-State Travel 301.53 2,484.90BECKER ARENA PRODUCTS Rec Center Gen Division G&A Admin/Office Supplies & Mat 2,484.90 64,800.00BERGERSON CASWELL INC Water G&A Repairs and Maintenance 64,800.00 1,300.00BERGLUND BRENDA Climate Investment G&A 1,300.00 2,337.00BESTAdminstrative Operations G&A Consulting Fees/Fees For Serv 2,337.00 5,170.55BITUMINOUS ROADWAYS INC Franchise Fees BS RETAINAGE PAYABLE 5,170.55 124.00BJT ROOFING Building and Energy G&A Construction Permits 124.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 4 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 434.52BOLTON & MENK INC Street Capital G&A Consulting Fees/Fees For Serv 1,869.56Franchise Fees G&A Consulting Fees/Fees For Serv 823.20Water G&A Consulting Fees/Fees For Serv 34.72Sewer G&A Consulting Fees/Fees For Serv 209.00Storm Water Utility G&A Consulting Fees/Fees For Serv 3,371.00 130.19BOUND TREE MEDICAL, LLC Fire Department G&A Operations Supplies & Mat 130.19 732.05BROOKSIDE NEIGHBORHOOD ASSOCIATION Neighborhood G&A Consulting Fees/Fees For Serv 732.05 4,500.00BRUCE E.BRANDSNESS & MICHAEL J.KRUMHOLZStreet Capital G&A 4,500.00 92.14BTR OF MINNESOTA LLC General Fund BS Inventory 92.14 553.40BUCKINGHAM TRUCKING LLC Solid Waste G&A Refunds/Reimbursements 179,259.34Solid Waste G&A Solid Waste Utility 105,757.08Solid Waste G&A Recycling Utility 285,569.82 65.00BUDGET SIGN Police G&A Operations Supplies & Mat 65.00 55.80BUDLONG ERIN Rec Center Gen Division G&A Refunds/Reimbursements 55.80 62.54BUSINESS ESSENTIALS Comm & Marketing G&A Admin/Office Supplies & Mat 62.54 280.00C&E AUTO UPHOLSTERY Vehicle Maintenance G&A Repairs and Maintenance 280.00 12,426.77CAMPBELL KNUTSON PROF ASSOC Adminstrative Operations G&A Consulting Fees/Fees For Serv 162.00IT G&A Consulting Fees/Fees For Serv 12,041.96MSA Capital G&A Consulting Fees/Fees For Serv 36.00Wooddale Station TIF G&A Consulting Fees/Fees For Serv 24,666.73 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 5 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 78.37CANON FINANCIAL IT G&A Short Term Lease/Rentals Pay 3,723.55Technology G&A Capitalized Tech Hardware 3,801.92 697.58CDW GOVERNMENT INC IT G&A Capitalized Tech Hardware 279.53Technology G&A Capitalized Tech Hardware 977.11 4,930.00CENTER FOR ENERGY AND ENVIRONMENT Sustainability G&A Consulting Fees/Fees For Serv 50,600.00Affordable H Trust G&A Consulting Fees/Fees For Serv 55,530.00 19.80CENTRAL MCGOWAN INC Aquatic Division G&A Admin/Office Supplies & Mat 19.80 11,274.38CENTRAL PENSION FUND Employee Benefits BS OTHER RETIREMENT 11,274.38 161.00CENTURY LINK IT G&A Telephone Communications 148.92-Technology G&A Other Communications 12.08 537.50CHUXWater G&A Operations Supplies & Mat 2,048.75Rec Center Gen Division G&A Other Supplies & Materials 2,586.25 1,197.13CINTAS CORPORATION Facilties Maintenance G&A Operations Supplies & Mat 156.14Public Works G&A Admin/Office Supplies & Mat 82.31Water G&A Admin/Office Supplies & Mat 69.91Park Maintenance G&A Admin/Office Supplies & Mat 291.49Rec Center Gen Division G&A Consulting Fees/Fees For Serv 2,441.94Rec Center Gen Division G&A Operations Supplies & Mat 67.10Vehicle Maintenance G&A Admin/Office Supplies & Mat 446.95Vehicle Maintenance G&A Operations Supplies & Mat 4,752.97 6,342.36CITY OF BLOOMINGTON Water Reilly G&A Consulting Fees/Fees For Serv 6,342.36 568.10CITY OF CRYSTAL Rec Center Gen Division G&A Other Gov Grants (non st/fed) City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 6 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 568.10 9,797.00CITY OF EDEN PRAIRIE Police G&A Consulting Fees/Fees For Serv 9,797.00 2,028.00CITY OF MINNEAPOLIS RECEIVABLES Police G&A Operations Supplies & Mat 2,028.00 30.82CLARKE LISA Assessing G&A Employee Mileage Reimbursement 30.82 524.53COLE PAPERS Facilties Maintenance G&A Operations Supplies & Mat 524.53 31,745.99COLICH & ASSOCIATES Adminstrative Operations G&A Consulting Fees/Fees For Serv 31,745.99 73,200.00COLLINS ELECTRICAL Public Works G&A Other Cap Equip Purchased 73,200.00 149.18COMCASTComm & Marketing G&A Consulting Fees/Fees For Serv 53.24Police G&A Electric Utility 101.82Fire Department G&A Electric Utility 31.83Fire Department G&A Operations Supplies & Mat 149.18Cable TV G&A Consulting Fees/Fees For Serv 29.74Rec Center Gen Division G&A Electric Utility 514.99 472.00CONTINENTAL RESEARCH CORP Rec Center Gen Division G&A Admin/Office Supplies & Mat 472.00 815.51COREMARKGeneral Fund BS Inventory 815.51 11.58COTTON ALISSA Park Maintenance G&A Operations Supplies & Mat 11.58 2,416.00COUGHLIN, JUDY Organized Rec G&A Consulting Fees/Fees For Serv 2,416.00 500.00CRARY JEROME General Fund BS UNION PARK APTS City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 7 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 500.00 128.56CROWN MARKING INC.Comm & Marketing G&A Admin/Office Supplies & Mat 128.56 33.99CROWN RENTAL - BURNSVILLE Park Maintenance G&A Other Supplies & Materials 33.99 119.00CULLIGAN BOTTLED WATER Facilties Maintenance G&A Consulting Fees/Fees For Serv 119.00 1,300.00CULTUREBROKERS LLC Adminstrative Operations G&A Consulting Fees/Fees For Serv 1,300.00 6,200.00CUSTOM PRODUCTS & SERVICES Facilties Maintenance G&A Consulting Fees/Fees For Serv 6,158.56SSD 1 G&A Consulting Fees/Fees For Serv 5,278.88SSD 2 G&A Consulting Fees/Fees For Serv 3,370.51SSD 3 G&A Consulting Fees/Fees For Serv 2,504.25SSD 4 G&A Consulting Fees/Fees For Serv 3,129.00SSD 5 G&A Consulting Fees/Fees For Serv 2,824.50SSD 6 G&A Consulting Fees/Fees For Serv 11,806.97Municipal Building & Infra G&A Consulting Fees/Fees For Serv 10,490.00Park Maintenance G&A Consulting Fees/Fees For Serv 1,800.00Rec Center Gen Division G&A Consulting Fees/Fees For Serv 53,562.67 3,474.00DAVID RIVERA Organized Rec G&A Consulting Fees/Fees For Serv 3,474.00 120.09DELEGARD TOOL CO Public Works G&A Operations Supplies & Mat 120.09 3,537.41DEPARTMENT OF LABOR & INDUSTRY Building and Energy G&A DUE TO OTHER GOVTS 3,537.41 10.00DEPARTMENT OF LABOR AND INDUSTRY Water G&A Consulting Fees/Fees For Serv 10.00 1,443.00DESIGN ELECTRIC INC Building and Energy G&A Construction Permits 1,443.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 8 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 548.73DETECTACHEM, INC.Police G&A Admin/Office Supplies & Mat 548.73 636.00DIESEL COMPONENTS INC General Fund BS Inventory 636.00 580.47DILLON KIM Water G&A 580.47 855.75DJ ELECTRIC SERVICES INC Park Maintenance G&A Repairs and Maintenance 855.75 4,983.35DO-GOOD.BIZ INC Comm & Marketing G&A Postage & Delivery 192.47Street Capital G&A Consulting Fees/Fees For Serv 895.62Franchise Fees G&A Consulting Fees/Fees For Serv 296.00Water G&A Consulting Fees/Fees For Serv 58.08Sewer G&A Consulting Fees/Fees For Serv 153.33Storm Water Utility G&A Consulting Fees/Fees For Serv 6,578.85 1,000.00DUFFY LYNN General Fund BS UNION PARK APTS 1,000.00 500.00ECHO DATA ANALYTICS Fire Department G&A Consulting Fees/Fees For Serv 500.00 1,224.98ECM PUBLISHERS INC City Clerk's Office G&A Postage & Delivery 1,224.98 549.00EDUCATION & TRAINING SERVICES Vehicle Maintenance G&A Other Travel, Conv & Conf 549.00 920.33EMERGENCY APPARATUS MTNCE General Fund BS Inventory 920.33 3,150.01ENTERPRISE FM TRUST Vehicle Maintenance G&A Short Term Lease/Rentals Pay 3,150.01 1,800.00ERWIN COURTNEY Climate Investment G&A 1,800.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 9 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 8,550.00ESS BROTHERS & SONS INC Storm Water Utility G&A 8,550.00 520.93EVERS LUANN Climate Investment G&A 130.23Park Improvement G&A Consulting Fees/Fees For Serv 651.16 1,407.49FACTORY MOTOR PARTS CO General Fund BS Inventory 200.06Vehicle Maintenance G&A Admin/Office Supplies & Mat 1,607.55 175.00FARRIS YOLANDA Adminstrative Operations G&A Out-of-State Travel 175.00 5,000.00FAUL PSYCHOLOGICAL PLLC Human Resources G&A Consulting Fees/Fees For Serv 6,475.00Human Resources G&A RECRUITMENT 11,475.00 1,328.50FERGUSON WATERWORKS Water G&A Operations Supplies & Mat 1,328.50 322.64FERRELLGASRec Center Gen Division G&A Vehicle Fuels 66.53Vehicle Maintenance G&A Vehicle Fuels 389.17 825.00FIDELIS SAFETY SOLUTIONS Fire Department G&A Consulting Fees/Fees For Serv 825.00 581.76FINANCE & COMMERCE, INC.Storm Water Utility G&A Consulting Fees/Fees For Serv 581.76 310.72FIRE SAFETY USA INC Fire Department G&A Operations Supplies & Mat 310.72 110.13FIRST ADVANTAGE Human Resources G&A Consulting Fees/Fees For Serv 110.13 15,750.00FISCHER BROS LLC Park Improvement G&A Consulting Fees/Fees For Serv 15,750.00 400.00FITZGERALD PETER Affordable H Trust G&A Consulting Fees/Fees For Serv City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 10 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 400.00 2,450.00FLAGSHIP RECREATION LLC Park Maintenance G&A Operations Supplies & Mat 2,450.00 3,150.00FLOCK GROUP INC Police G&A Admin/Office Supplies & Mat 3,150.00 127.95FRATTALLONESRec Center Gen Division G&A Operations Supplies & Mat 127.95 570.88FREDENBURG, DAVID Climate Investment G&A 142.72Park Improvement G&A Consulting Fees/Fees For Serv 713.60 369.06FREEDOM FOREVER LLC Building and Energy G&A Construction Permits 369.06 38.86FRIEDERICH NIKKI Organized Rec G&A Employee Mileage Reimbursement 38.86 200.00FRONTIER ENERGY INC Climate Investment G&A 200.00 169.00GAREIS CHRIS Building and Energy G&A Dues, Memberships, Licenses 169.00 700.00GEHMIE LARISA Climate Investment G&A 700.00 10,373.09GERBER COLLISION- MIDWEST INC Property Casualty G&A Property Insurance 10,373.09 1,280.00GOLDEN VALLEY, CITY OF Organized Rec G&A Consulting Fees/Fees For Serv 1,280.00 464.40GOPHER STATE ONE-CALL INC Water G&A 1,536.30Water G&A OTHER IMPROVEMENT SERVICE 2,000.70 38.50GRAINGER INC.General Fund BS Inventory City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 11 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 105.88Facilties Maintenance G&A Operations Supplies & Mat 85.39Park Maintenance G&A Other Supplies & Materials 926.56Rec Center Gen Division G&A Operations Supplies & Mat 99.22Vehicle Maintenance G&A Admin/Office Supplies & Mat 1,997.45Vehicle Maintenance G&A Operations Supplies & Mat 3,253.00 346.97HAAG COMPANIES INC Municipal Building & Infra G&A Other Supplies & Materials 346.97 113.08HACH CO Water G&A Operations Supplies & Mat 113.08 150.00HAWKINS INC Water G&A Admin/Office Supplies & Mat 18,626.43Water G&A Operations Supplies & Mat 18,776.43 10,747.00HEALTHPARTNERSHuman Resources G&A Consulting Fees/Fees For Serv 3,807.00Human Resources G&A RECRUITMENT 14,554.00 6.00HENNEPIN COUNTY Per Impr Rev G&A Consulting Fees/Fees For Serv 6.00 247,000.00HENNEPIN COUNTY COURT ADMINISTRATOR Street Capital G&A 247,000.00 10,653.00HENNEPIN COUNTY TREASURER Police G&A Consulting Fees/Fees For Serv 3,722.52Police G&A EQUIPMENT MTCE SERVICE 2,500.02Fire Department G&A Radio Communications 208.39Public Works G&A Radio Communications 208.39Water G&A Radio Communications 208.40Sewer G&A Radio Communications 208.40Storm Water Utility G&A Radio Communications 395.61Park Maintenance G&A Solid Waste Utility 369.99Park Maintenance G&A Other Supplies & Materials 18,474.72 5,136.00HENNEPIN HEALTHCARE Fire Department G&A Other Travel, Conv & Conf 5,136.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 12 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 177.00HENRICKSEN PSG Facilties Maintenance G&A Consulting Fees/Fees For Serv 177.00 53.48HIRSHFIELDSFacilties Maintenance G&A Operations Supplies & Mat 53.48 30.84HOME DEPOT CREDIT SERVICES Facilties Maintenance G&A Admin/Office Supplies & Mat 201.20Facilties Maintenance G&A Operations Supplies & Mat 324.60Public Works G&A Operations Supplies & Mat 355.79Water G&A Operations Supplies & Mat 926.05Park Maintenance G&A Other Supplies & Materials 48.00Rec Center Gen Division G&A Operations Supplies & Mat 1,886.48 4,500.00HOMESTEAD ROAD General Fund BS UNION PARK APTS 4,500.00 3,000.00I & S GROUP INC Sewer G&A Consulting Fees/Fees For Serv 3,000.00 1,575.00I.U.O.E. LOCAL NO 49 Employee Benefits BS UNION DUES 1,575.00 2,565.00ICE SPORTS INDUSTRY INSTRUCTIONAL SKATING LESSONS SUBSCRIPTIONS/MEMBERSHIPS 2,565.00 3,013.59IDEAL COMMERCIAL INTERIORS LLC Facilties Maintenance G&A GENERAL SUPPLIES 3,013.59 1,692.00IDENTISYSHuman Resources G&A Consulting Fees/Fees For Serv 1,692.00 2,985.13IMAGETREND, INC IT G&A Software Licensing Less 12 Mo 2,985.13 870.36IMPACT POWER TO CONNECT Water G&A Postage & Delivery 870.36Sewer G&A Postage & Delivery 870.36Solid Waste G&A Postage & Delivery 870.36Storm Water Utility G&A Postage & Delivery 3,481.44 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 13 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 744.63INDELCOPublic Works G&A Operations Supplies & Mat 19.84Public Works G&A Other Supplies & Materials 93.70Water G&A Operations Supplies & Mat 5,273.88Park Maintenance G&A Operations Supplies & Mat 6,132.05 8,917.00INTECH SOFTWARE SOLUTIONS INC Adminstrative Operations G&A Software Licensing Less 12 Mo 8,917.00 338.59INVER GROVE FORD General Fund BS Inventory 338.59 947.78I-STATE TRUCK CENTER General Fund BS Inventory 947.78 307.00J & F REDDY RENTS Adminstrative Operations G&A Short Term Lease/Rentals Pay 307.00 1,300.33JAYTECH, INC.Rec Center Gen Division G&A Consulting Fees/Fees For Serv 1,300.33 55.00JERNANDER MICHAEL Fire Department G&A Other Travel, Conv & Conf 55.00 6.17JERRY'S HARDWARE Westwood G&A Operations Supplies & Mat 6.17 2,100.00JOHNSON AVERY Employee Benefits G&A Consulting Fees/Fees For Serv 2,100.00 1,958.88JOHNSON PAPER & SUPPLY CO.Rec Center Gen Division G&A Admin/Office Supplies & Mat 1,958.88 400.00JONES LEVY Organized Rec G&A Consulting Fees/Fees For Serv 400.00 12.73JUREK JESSIE Assessing G&A Employee Mileage Reimbursement 12.73 41,145.00KARELA CONSTRUCTION General Fund BS UNION PARK APTS 41,145.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 14 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 115.00KIDROWSKI HOLLY Rec Center Gen Division G&A Consulting Fees/Fees For Serv 115.00 3,371.60KIMLEY-HORN AND ASSOCIATES, INC Street Capital G&A Consulting Fees/Fees For Serv 17,470.99Franchise Fees G&A Consulting Fees/Fees For Serv 3,371.60Water G&A Consulting Fees/Fees For Serv 2,145.56Sewer G&A Consulting Fees/Fees For Serv 4,291.12Storm Water Utility G&A Consulting Fees/Fees For Serv 30,650.87 925.00KIMLEY-HORN AND ASSOCIATES, INC.Park Improvement G&A Consulting Fees/Fees For Serv 47,203.06MSA Capital G&A Consulting Fees/Fees For Serv 48,128.06 139.14KINGS III OF AMERICA LLC Facilties Maintenance G&A Consulting Fees/Fees For Serv 139.14 1,800.00KLMD PROPERTIES Park Maintenance G&A Consulting Fees/Fees For Serv 1,800.00 89.99KOZLOWSKI ROBERT Water G&A Consulting Fees/Fees For Serv 89.99 2,400.00KURITA AMERICA, INC Water G&A 2,400.00 116.00LARSON KRISTY Building and Energy G&A Licenses 116.00 4,030.62LAW ENFORCEMENT LABOR SERVICES INC Employee Benefits BS UNION DUES 4,030.62 13.00LAWLOR SUSAN Rec Center Gen Division G&A Refunds/Reimbursements 13.00 133.05LAWSON PRODUCTS INC Vehicle Maintenance G&A Admin/Office Supplies & Mat 46.27Vehicle Maintenance G&A Operations Supplies & Mat 179.32 1,830.00LEAGUE OF MINNESOTA CITIES Storm Water Utility G&A Dues, Memberships, Licenses City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 15 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 1,830.00 600.00LEGEND TECHNICAL SERVICES Building and Energy G&A Admin/Office Supplies & Mat 840.00Water Reilly G&A Consulting Fees/Fees For Serv 1,440.00 510.10LEICA GEOSYSTEMS INC Engineering G&A OPERATIONAL SUPPLIES 510.10 850.00LEO'S LANDSERVICE LLC Park Maintenance G&A Consulting Fees/Fees For Serv 850.00 149.25LIBERTY TIRE Vehicle Maintenance G&A Recycling Utility 149.25 1,669.18LIFE GUARDIAN WORLDWIDE LLC Police G&A Out-of-State Travel 15,000.00Police G&A Other Travel, Conv & Conf 16,669.18 3,137.00LIFE SAFETY SYSTEMS Facilties Maintenance G&A Consulting Fees/Fees For Serv 839.00Facilties Maintenance G&A Repairs and Maintenance 3,976.00 1,161.35LITTLE FALLS MACHINE INC General Fund BS Inventory 1,161.35 310.00LOCKGUARD LOCKSMITHS Facilties Maintenance G&A Consulting Fees/Fees For Serv 1,310.00Facilties Maintenance G&A Repairs and Maintenance 170.00Rec Center Gen Division G&A Consulting Fees/Fees For Serv 139.65ROC Division G&A Repairs and Maintenance 1,929.65 313.02LOFFLERIT G&A Capitalized Tech Hardware 313.02 911.52LOFFLER COMPANIES IT G&A Computers/Tech Services 674.42IT G&A Operations Supplies & Mat 1,585.94 10.72LOMBARDI, JIM Organized Rec G&A Employee Mileage Reimbursement 10.72 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 16 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 482.15LUBE-TECH RELIABLE PLUS Vehicle Maintenance G&A Admin/Office Supplies & Mat 3,338.71Vehicle Maintenance G&A Vehicle Lubricants/Additives 3,820.86 1,000.00LVC COMPANIES INC Facilties Maintenance G&A Repairs and Maintenance 1,000.00 1,002.30M.SHOEN ROBIN Employee Benefits G&A Consulting Fees/Fees For Serv 1,002.30 622.55MACQUEEN EQUIP CO Fire Department G&A Operations Supplies & Mat 622.55 1,300.00MALI YOGESH Climate Investment G&A 1,300.00 62.31MANDLER, CARRIE Westwood G&A Employee Mileage Reimbursement 62.31 3,300.00MARIE RIDGEWAY LICSW LLC Police G&A Consulting Fees/Fees For Serv 3,300.00 360.00MARTIN MARIETTA MATERIALS Water G&A 360.00 823.20MASTER TECHNOLOGY GROUP IT G&A Computers/Tech Services 823.20 285.04MATHESON TRI-GAS, INC.Vehicle Maintenance G&A Admin/Office Supplies & Mat 285.04 1,452.87MAURER JUSTIN Employee Benefits G&A Consulting Fees/Fees For Serv 1,452.87 396.29MCBRIDE BRIAN Climate Investment G&A 169.84Park Improvement G&A Consulting Fees/Fees For Serv 566.13 225.90MCCLELLAN SALES INC Public Works G&A Operations Supplies & Mat 225.90 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 17 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 125.00MCMAAdminstrative Operations G&A Other Travel, Conv & Conf 125.00 23.16MENARDSPark Maintenance G&A Operations Supplies & Mat 16.67Westwood G&A Operations Supplies & Mat 39.83 868.00MESSERLI & KRAMER Employee Benefits BS WAGE GARNISHMENTS 868.00 3,400.00METRO WATERSHED PARTNERS Storm Water Utility G&A Dues, Memberships, Licenses 3,400.00 432,100.77METROPOLITAN COUNCIL Sewer G&A Water Utility 432,100.77 681.32MGX EQUIPMENT SERVICES, LLC General Fund BS Inventory 11,341.00Vehicle Maintenance G&A Other Cap Equip Purchased 12,022.32 76.00MIKE'S ELECTRICAL CONTRACTING Building and Energy G&A Construction Permits 76.00 2,000.00MILLMAN STEVEN Climate Investment G&A 2,000.00 44.47MINIKAHDA VISTA NEIGHBORHOOD ASSN Neighborhood G&A Consulting Fees/Fees For Serv 44.47 1,694.38MINNESOTA CHILD SUPPORT PYT CTR Employee Benefits BS WAGE GARNISHMENTS 1,694.38 1,080.00MINNESOTA CONTROL SYSTEMS, LLC.Rec Center Gen Division G&A Consulting Fees/Fees For Serv 1,080.00 674.32MINNESOTA EQUIPMENT General Fund BS Inventory 674.32 538.02MN DEPT OF TRANSPORTATION MSA Capital G&A Consulting Fees/Fees For Serv 65.192024B GO Bonds Water G&A Consulting Fees/Fees For Serv City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 18 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 1.32Sewer G&A Consulting Fees/Fees For Serv 4.36Storm Water Utility G&A Consulting Fees/Fees For Serv 608.89 75.00MN NIGP Vehicle Maintenance G&A Dues, Memberships, Licenses 75.00 8,000.00MOMETUM ADVOCACY LLP Adminstrative Operations G&A Consulting Fees/Fees For Serv 8,000.00 456.41MPX GROUP Comm & Marketing G&A Consulting Fees/Fees For Serv 456.41 350.00MR CUTTING EDGE Rec Center Gen Division G&A Repairs and Maintenance 350.00 589.10MSC INDUSTRIAL SUPPLY CO.General Fund BS Inventory 404.00-Vehicle Maintenance G&A GENERAL SUPPLIES 185.10 51.00MUNICIPAL EMERGENCY SERVICES Fire Department G&A Operations Supplies & Mat 51.00 7,591.20MUSIC TOGETHER IN THE VALLEY LLC Organized Rec G&A Consulting Fees/Fees For Serv 7,591.20 30.00MUZZIO ERIN Organized Rec G&A Refunds/Reimbursements 30.00 368.00MVTL LABORATORIES Water G&A Consulting Fees/Fees For Serv 245.00Water Reilly G&A Consulting Fees/Fees For Serv 613.00 1,000.00NACHSHON & CHASIDA FERTEL General Fund BS UNION PARK APTS 1,000.00 2,090.07NAPA (GENUINE PARTS CO)General Fund BS Inventory 315.91Public Works G&A Other Supplies & Materials 5.99Vehicle Maintenance G&A Admin/Office Supplies & Mat 528.99Vehicle Maintenance G&A Operations Supplies & Mat 2,940.96 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 19 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 8,721.09NEARMAP US INC IT G&A Software Licensing Less 12 Mo 8,721.09 250.00NOKOMIS SHOE SHOP Facilties Maintenance G&A Operations Supplies & Mat 250.00Park Maintenance G&A Admin/Office Supplies & Mat 229.95Rec Center Gen Division G&A Operations Supplies & Mat 729.95 1,369.13NORTH AMERICAN SAFETY INC Park Maintenance G&A Operations Supplies & Mat 1,369.13 51,117.60NORTH COUNTRY CHEVROLET GMC Vehicle Maintenance G&A Vehicles/Machinery Purch 51,117.60 111.54NORTHERN SAFETY TECHNOLOGY INC General Fund BS Inventory 1,967.36Vehicle Maintenance G&A Vehicles/Machinery Purch 2,078.90 320.00NORTHERN'S HEATING AND AIR Building and Energy G&A Construction Permits 320.00 1,282.95NORTHWEST LASERS & INSTRUMENTS Engineering G&A Consulting Fees/Fees For Serv 1,282.95 8,168.94NYSTROM PUBLISHING Comm & Marketing G&A Consulting Fees/Fees For Serv 8,168.94 244.55ODP BUSINESS SOLUTIONS LLC Human Resources G&A Admin/Office Supplies & Mat 151.87Comm & Marketing G&A Admin/Office Supplies & Mat 270.48Finance G&A Admin/Office Supplies & Mat 88.82Community Development G&A Admin/Office Supplies & Mat 29.20Police G&A Postage & Delivery 190.38Police G&A Admin/Office Supplies & Mat 199.82Building and Energy G&A Admin/Office Supplies & Mat 88.60Public Works G&A Admin/Office Supplies & Mat 80.20Organized Rec G&A Admin/Office Supplies & Mat 63.67Organized Rec G&A Operations Supplies & Mat 139.43Westwood G&A Admin/Office Supplies & Mat 1,547.02 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 20 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 67.94OESTREICH, MARK Westwood G&A In-State Travel 67.94 97.82OKEY MIKE Public Works G&A Employee Mileage Reimbursement 97.82 300.00OLSON MARILYN Water G&A 300.00 201.00ON SITE SANITATION Organized Rec G&A Consulting Fees/Fees For Serv 201.00 1,756.45OVERHEAD DOOR CO Facilties Maintenance G&A Repairs and Maintenance 1,756.45 1,216.10OVERHEAD DOOR COMPANY OF THE NORTHLANDFacilties Maintenance G&A Consulting Fees/Fees For Serv 910.90Facilties Maintenance G&A Repairs and Maintenance 3,056.00Property Casualty G&A Property Insurance 5,183.00 364.48OXYGEN SERVICE COMPANY INC Fire Department G&A Operations Supplies & Mat 364.48 321.00PACE ANALYTICAL SERVICES INC Water G&A Consulting Fees/Fees For Serv 321.00 450.00PARTY UNIT Organized Rec G&A Consulting Fees/Fees For Serv 450.00 160.00PER MAR SECURITY SERVICES Water G&A Repairs and Maintenance 160.00 4,000.00PERKINS KATHLEEN Climate Investment G&A 4,000.00 300.00PERPICH MICHELE Water G&A Consulting Fees/Fees For Serv 300.00 690.84PLAYPOWER LT FARMINGTON INC Park Maintenance G&A Operations Supplies & Mat 690.84 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 21 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 534.46POMP'S TIRE SERVICE INC Vehicle Maintenance G&A Repairs and Maintenance 534.46 327.75PRECISE MRM, LLC.Public Works G&A Computers/Tech Services 327.75Water G&A Computers/Tech Services 327.75Sewer G&A Computers/Tech Services 327.75Storm Water Utility G&A Computers/Tech Services 1,311.00 2,988.00PRECISION LANDSCAPE AND TREE, INC. Per Impr Rev G&A Consulting Fees/Fees For Serv 2,988.00 338.67PREMIUM WATERS Fire Department G&A Operations Supplies & Mat 338.67 58,643.80PRO-TREE OUTDOOR SERVICES Natural Resources G&A Consulting Fees/Fees For Serv 58,643.80 7,500.00PRUETER JOHN General Fund BS UNION PARK APTS 7,500.00 21,500.00QUALITY FLOW SYSTEMS INC Sewer G&A Operations Supplies & Mat 30,625.00Storm Water Utility G&A Operations Supplies & Mat 52,125.00 4,617.00RANGE RENOVATION CONSULTING, INC. Facilties Maintenance G&A Consulting Fees/Fees For Serv 4,617.00 494.48REACH FOR RESOURCES INC Organized Rec G&A Consulting Fees/Fees For Serv 494.48 600.00REACH MEDIA NETWORK Rec Center Gen Division G&A Software Licensing Less 12 Mo 600.00 196.17RED WING BUSINESS ADVANTAGE ACCOUNT Facilties Maintenance G&A Operations Supplies & Mat 196.17 224.99RED WING STORE Water G&A Operations Supplies & Mat 224.99 375.00REDMOND, BETH Organized Rec G&A Refunds/Reimbursements City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 22 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 375.00 2,095.40REISSMANN-DORING CASSI Employee Benefits G&A Consulting Fees/Fees For Serv 2,095.40 687.51REM 5 Adminstrative Operations G&A Licenses 687.51 7,316.44REPUBLIC SERVICES Facilties Maintenance G&A Solid Waste Utility 75,877.41Solid Waste G&A Organics Utility Expense 6,366.73Rec Center Gen Division G&A Solid Waste Utility 89,560.58 1,190.60RHYNER JESSICA Climate Investment G&A 1,190.60 1,504.96ROBERT B HILL CO Facilties Maintenance G&A Operations Supplies & Mat 1,504.96 360.00ROBERT BRANDON ALLEN Building and Energy G&A Licenses 360.00 5,599.25ROBERT HALF TECHNOLOGY Community Development G&A Consulting Fees/Fees For Serv 1,674.44Water G&A Consulting Fees/Fees For Serv 1,674.44Sewer G&A Consulting Fees/Fees For Serv 1,674.44Solid Waste G&A Consulting Fees/Fees For Serv 1,674.44Storm Water Utility G&A Consulting Fees/Fees For Serv 12,297.01 1,500.00ROEMEN JULIE Climate Investment G&A 1,500.00 475.00ROOT-O-MATIC Facilties Maintenance G&A Repairs and Maintenance 475.00 175.34ROSEVILLE MIDWAY FORD General Fund BS Inventory 175.34 6,000.00RSRC LIV LLC Affordable H Trust G&A Consulting Fees/Fees For Serv 6,000.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 23 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 150.00SAFELITE FULFILLMENT INC Vehicle Maintenance G&A Repairs and Maintenance 150.00 1,191.00SAFFORD TONY Climate Investment G&A 1,191.00 1,418.16SAND CREEK EAP LLC Employee Benefits G&A HEALTH INSURANCE 1,418.16 1,100.80SCAN AIR FILTER INC Facilties Maintenance G&A Operations Supplies & Mat 674.19Rec Center Gen Division G&A Operations Supplies & Mat 1,774.99 75.00SCHAUB CAROL Climate Investment G&A 75.00 1,217.00SESACAquatic Division G&A Dues, Memberships, Licenses 1,217.00 29,360.00SHADYWOOD TREE EXPERTS & LANDSCAPING Natural Resources G&A Consulting Fees/Fees For Serv 29,360.00 1,053.23SHAPCO PRINTING INC Adminstrative Operations G&A Operations Supplies & Mat 1,053.23 594.92SHILOG LTD Water G&A Operations Supplies & Mat 594.92 3,167.58SHORT ELLIOTT HENDRICKSON, INC.General Fund BS CO ESCROW 3,167.58 23.19SHRED-IT Adminstrative Operations G&A Consulting Fees/Fees For Serv 81.67Community Development G&A Consulting Fees/Fees For Serv 104.86 670.00SIGNATURE MECHANICAL INC Rec Center Gen Division G&A Repairs and Maintenance 670.00 2,613.76SLP FF ASSOC IAFF LOCAL #993 Employee Benefits BS UNION DUES 2,613.76 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 24 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 22.45SPS COMPANIES INC Facilties Maintenance G&A Operations Supplies & Mat 5,632.50Water G&A Operations Supplies & Mat 5,654.95 200.00ST LOUIS PARK SUNRISE ROTARY Adminstrative Operations G&A Dues, Memberships, Licenses 200.00 23.09STERICYCLE, INC.Adminstrative Operations G&A Consulting Fees/Fees For Serv 325.89Finance G&A Consulting Fees/Fees For Serv 71.21Facilties Maintenance G&A Consulting Fees/Fees For Serv 711.15Police G&A Consulting Fees/Fees For Serv 23.09Building and Energy G&A Consulting Fees/Fees For Serv 602.60Water G&A Consulting Fees/Fees For Serv 1,757.03 1,300.00STOCKTON DANIEL General Fund BS UNION PARK APTS 1,300.00 5,450.00STRATUS BUILDING SOLUTIONS OF ST. PAUL Facilties Maintenance G&A Consulting Fees/Fees For Serv 3,550.00Rec Center Gen Division G&A Consulting Fees/Fees For Serv 9,000.00 2,879.65STREICHER'S Police G&A Admin/Office Supplies & Mat 11,589.95Police G&A Operations Supplies & Mat 14,469.60 7.01SUBURBAN CHEVROLET General Fund BS Inventory 7.01 60.00SUBURBAN ELECTRIC Building and Energy G&A Construction Permits 60.00 3,942.36SUBURBAN TIRE WHOLESALE General Fund BS Inventory 3,942.36 875.00SUSA TREASURER Water G&A Dues, Memberships, Licenses 875.00 1,234.80SVL SERVICE Facilties Maintenance G&A Operations Supplies & Mat 1,234.80 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 25 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 1,640.00SWANK MOTION PICTURES, INC.Organized Rec G&A Consulting Fees/Fees For Serv 1,640.00 14,456.89TARGETSOLUTIONS LEARNING, LLC Police G&A Software Licensing Less 12 Mo 14,456.89 90.95TENNANT SALES AND SERVICE CO.Facilties Maintenance G&A Operations Supplies & Mat 90.95 918.00TERMINIX COMMERCIAL Facilties Maintenance G&A Consulting Fees/Fees For Serv 131.00Rec Center Gen Division G&A Consulting Fees/Fees For Serv 1,049.00 96.00THE SIGN PRODUCERS INC Facilties Maintenance G&A Consulting Fees/Fees For Serv 96.00 385.23THOMSON REUTERS WEST PAYMENT CENTER Police G&A Operations Supplies & Mat 385.23 361.45THRIVEPASSHuman Resources G&A Consulting Fees/Fees For Serv 361.45 452.50TIMESAVER OFF SITE SECRETARIAL Adminstrative Operations G&A Consulting Fees/Fees For Serv 452.50 1,264.96TK ELEVATOR CORPORATION Rec Center Gen Division G&A Repairs and Maintenance 1,264.96 13.64TOLL GAS & WELDING SUPPLY Water G&A Operations Supplies & Mat 318.39Vehicle Maintenance G&A Admin/Office Supplies & Mat 332.03 889.00TRAFFIC CONTROL CORP Public Works G&A Operations Supplies & Mat 889.00 264.20TRANSPORT GRAPHICS Fire Department G&A Operations Supplies & Mat 264.20 245.00TRUNORTH SOLAR Facilties Maintenance G&A Repairs and Maintenance 245.00 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 26 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 1,500.00TWIN CITIES FIRE TACTICS LLC Fire Department G&A Other Travel, Conv & Conf 1,500.00 2,860.00TWIN CITY OUTDOOR SERVICES INC SSD 1 G&A Consulting Fees/Fees For Serv 1,181.50SSD 3 G&A Consulting Fees/Fees For Serv 4,041.50 600.00TYSLEY TAYLOR Adminstrative Operations G&A Consulting Fees/Fees For Serv 600.00 360.00UHL CO INC Facilties Maintenance G&A Consulting Fees/Fees For Serv 360.00 153.27ULINEOrganized Rec G&A Operations Supplies & Mat 467.47Rec Center Gen Division G&A Admin/Office Supplies & Mat 620.74 1,697.50USDA, APHIS, GENERAL Natural Resources G&A Consulting Fees/Fees For Serv 1,697.50 13,564.93VALLEY-RICH CO INC Water G&A 58,535.76Sewer G&A 72,100.69 145.00VERIFIED CREDENTIALS LLC.Human Resources G&A Consulting Fees/Fees For Serv 145.00 14,270.38VERIZONIT G&A Telephone Communications 14,270.38 150.00VERIZON WIRELESS Police G&A Operations Supplies & Mat 150.00 8,700.00VETERAN ELECTRIC Municipal Building & Infra G&A Consulting Fees/Fees For Serv 350.00Park Maintenance G&A Consulting Fees/Fees For Serv 530.00Rec Center Gen Division G&A Consulting Fees/Fees For Serv 530.00Rec Center Gen Division G&A Repairs and Maintenance 10,110.00 540.00WACONIA ROLL-OFF SERVICE Park Maintenance G&A Solid Waste Utility 275.00Park Maintenance G&A Recycling Utility City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 27 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description 815.00 579.00WARNING LITES OF MN INC Water G&A 579.00 596.56WATER CONSERVATION SERVICE INC Water G&A 596.56 154.80WERNER RONALD Climate Investment G&A 66.34Park Improvement G&A Consulting Fees/Fees For Serv 221.14 1,011.28WINSUPPLY OF EDEN PRAIRIE Public Works G&A Operations Supplies & Mat 1,011.28 413.29WITMER PUBLIC SAFETY GROUP INC Fire Department G&A Operations Supplies & Mat 413.29 21,334.06WM CORPORATE SERVICES INC Solid Waste G&A Yard Waste Utility 21,334.06 3,256.00WSB ASSOC INC IT G&A Consulting Fees/Fees For Serv 9,953.75Storm Water Utility G&A Consulting Fees/Fees For Serv 13,209.75 2,899.75XCEL ENERGY Facilties Maintenance G&A Electric Utility 84.25Public Works G&A Consulting Fees/Fees For Serv 8,568.74Public Works G&A Electric Utility 20,537.37Water G&A Electric Utility 1,588.94Water Reilly G&A Electric Utility 5,094.68Sewer G&A Electric Utility 1,980.08Storm Water Utility G&A Electric Utility 6,016.41Park Maintenance G&A Electric Utility 46,770.22 1,109.20ZAHNER JOSEPH Climate Investment G&A 1,109.20 235.77ZOLL MEDICAL CORPORATION Fire Department G&A Operations Supplies & Mat 235.77 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 28 CITY OF ST LOUIS PARK Council Check Summary 1/20/202512/21/2024 - Amount ObjectVendorBU Description Report Totals 2,474,358.87 City council meeting of February 3, 2025 (Item No. 5a) Title: Approve city disbursements Page 29 Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5b Executive summary Title: Resolution approving liquor license renewals Recommended action: Motion to adopt resolution approving the renewal of liquor licenses for the license term March 1, 2025, through Feb. 28, 2026. Policy consideration: Do the applicants meet the requirements of the city and state for renewal of their liquor licenses? Summary: On Dec. 9, 2024, the city clerk’s office distributed materials to current liquor license holders to renew their licenses for the term March 1, 202 5 to Feb. 28, 2026. Renewal materials include state and city renewal applications, proof of liquor liability insurance, proof of workers compensation insurance, CPA statements when required by code and license fees. During the 2024-2025 licensing period, the following establishment changes took place: • Angel Food / FrioFrio – elected not to renew their license • Boketto – new on-sale intoxicating liquor license with Sunday sales • Copperwing Distillery – change in ownership structure • Game Show Battle Rooms – new on-sale wine license • Haggard Barrel Brewing Co., LLC – new off-sale brewery • Marcus West End Cinema – new on-sale intoxicating liquor license with Sunday sales • McCoy’s Public House – closed • Punch Neapolitan Pizza – new on-sale wine license • REM 5 Virtual Reality Laboratory - elected not to renew their license • Revival – closed • Showplace 14 #8863 – closed • TGI Friday’s – closed • Ullsperger Brewing, LLC – off-sale brewers (had existing on-sale brewers taproom) • Wells Roadside – new on-sale intoxicating liquor license with Sunday sales Establishments listed in Exhibit A have met the criteria necessary for renewal of their liquor license. If all eligible licenses are renewed, the city will have a total of 56 liquor licenses. Financial or budget considerations: Liquor license fees are set by city code and state statute and are reviewed annually. Strategic priority consideration: Not applicable. Supporting documents: Discussion Resolution Exhibit A – list of establishments and license fees Prepared by: Amanda Scott-Lerdal, deputy city clerk Reviewed by: Melissa Kennedy, city clerk Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 5b) Page 2 Title: Resolution approving liquor license renewals Discussion Background: Liquor licensing is regulated by St. Louis Park City Code, Chapter 3 and Minnesota Statutes Chapter 340A. The licensing period for liquor is one year, beginning March 1 and ending on February 28. In addition to reviewing overall compliance with the rules and regulations set forth in city code and state statute related to the sale and service of alcohol and the requirements for licensure, staff also review renewal applications to ensure they align with the following sections of the city code: City code Sec. 3-64. Renewal application. (a) Applications for the renewal of an existing liquor license shall be made at least 45 days prior to the date of the expiration of the license and shall state that everything in the prior application remains true and correct except as otherwise indicated on the renewal application. (b) Renewal applications for an on-sale intoxicating liquor license for a restaurant shall include a certified public accountant's statement showing total sales, food sales, liquor sales and percentage of total sales of the restaurant for the previous year. City code Sections 3-57 and 3-70 require the holders of on-sale intoxicating and on-sale wine licenses to comply with the following requirements: • On-sale intoxicating liquor license - must have a minimum of 40 percent of gross receipts attributable to the sale of food. • On-sale wine license - The holder of a wine license, who is also licensed to sell 3.2 percent malt liquor on-sale and whose gross receipts are at least 60 percent attributable to the sale of food, may also sell intoxicating malt liquor at on-sale without an additional license. o Note: this is a statutory provision that only applies to those licensees who want to maintain authorization to sell on-sale intoxicating malt liquor (strong beer) in conjunction with their wine license. If the licensee does not want this authorization, they need not comply. As required in city code section 3-70, all property tax payments for licensed establishments are current. Staff Recommendation: The city clerk’s office reviews all application information and works with the police department and the State of Minnesota to ensure that all licensees meet the necessary criteria for renewal of their liquor license. All license renewals and applications listed on Exhibit A of the resolution have met the requirements in city code and state law. Staff recommend approval and issuance of the appropriate license to each establishment listed on Exhibit A for the term of March 1, 2025, to Feb. 28, 2026. City council meeting of February 3, 2025 (Item No. 5b) Page 3 Title: Resolution approving liquor license renewals Resolution No. 25-____ Approving renewal of liquor licenses for the license period March 1, 2025 through February 28, 202 6 Whereas, Minnesota Statutes Chapter 340A and St. Louis Park City Code Chapter 3 provide for liquor licensing in cooperation with the Alcohol and Gambling Enforcement Division of the Minnesota Department of Public Safety; and Whereas, no license may be issued or renewed if required criteria have not been met; and Now therefore be it resolved by the St. Louis Park City Council that the applicants and establishments listed in Exhibit A have met the criteria necessary for issuance of their respective liquor licenses, and the applications are hereby approved for March 1, 202 5, to February 28, 2026. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk City council meeting of February 3, 2025 (Item No. 5b) Page 4 Title: Resolution approving liquor license renewals Exhibit A Establishment Name Address License Type Total Fee AC St. Louis Park 5075 Wayzata Blvd. on-sale intoxicating & Sunday sales $8,950.00 Applebee's Neighborhood Grill & Bar 8312 Highway 7 on-sale intoxicating & Sunday sales $8,950.00 Boketto 1607 West End Blvd. on-sale intoxicating & Sunday sales $8,950.00 Bunny's Bar & Grill 5916 Excelsior Blvd on-sale intoxicating & Sunday sales $8,950.00 Costco Wholesale #377 5801 W 16th St off-sale $380.00 Courtyard Minneapolis West 9980 Wayzata Blvd. on-sale intoxicating & Sunday sales $8,950.00 Crave 1603 West End Blvd on-sale intoxicating & Sunday sales $8,950.00 Cub Foods 5370 16th Street W off-sale 3.2 $200.00 Cub Foods Knollwood 3620 Texas Ave S off-sale 3.2 $200.00 Cub Liquor 5370 16th Street W off-sale $380.00 Dancing Ganesha 8124 Hwy. 7 on-sale wine & 3.2 $2,750.00 DoubleTree Minneapolis Park Place 1500 Park Place Blvd on-sale intoxicating & Sunday sales $8,950.00 Frank Lundberg American Legion Post 282 6509 Walker St. on-sale intoxicating club & Sunday sales $700.00 Fresh Thyme Farmers Market 4840 Excelsior Blvd., Suite A off-sale 3.2 $200.00 Fresh Thyme Liquor 4840 Excelsior Blvd., Suite B off-sale $380.00 Game Show Battle Rooms 1661 West End Blvd on-sale intoxicating & Sunday sales $8,950.00 Haggard Barrel Brewing Co., LLC 6413 Cambridge Street Off-sale brewer $200.00 Hazelwood Food and Drink - St. Louis Park 4450 Excelsior Blvd. #120 on-sale intoxicating & Sunday sales $8,950.00 Homewood Suites 5305 Wayzata Blvd 3.2 on-sale & on-sale Sunday $750.00 Hope Breakfast Bar 5377 West 16th Street on-sale intoxicating & Sunday sales $8,950.00 Life Café 5525 Cedar Lake Road on-sale wine & 3.2 $2,750.00 Liquor Boy 5620 Cedar Lake Rd off-sale $380.00 Lunds & Byerlys St. Louis Park 3777 Park Ctr Blvd on-sale intoxicating & Sunday sales $8,950.00 Lunds & Byerlys Wines & Spirits 3785 Park Ctr Blvd off-sale $380.00 Marcus West End Cinema 1625 West End Blvd on-sale intoxicating & Sunday sales $8,950.00 Marriott Minneapolis West 9960 Wayzata Blvd on-sale intoxicating & Sunday sales $8,950.00 Mill Valley Kitchen 3906 Excelsior Blvd on-sale intoxicating & Sunday sales $8,950.00 Minneapolis Golf Club 2001 Flag Ave S on-sale intoxicating club & Sunday sales $700.00 City council meeting of February 3, 2025 (Item No. 5b) Page 5 Title: Resolution approving liquor license renewals Park Tavern Lounge & Lanes 3401 Louisiana Ave S on-sale intoxicating & Sunday sales $8,950.00 Parkway Pizza 6325 Minnetonka Blvd. on-sale wine & 3.2 $2,750.00 Punch Bowl Social 1691 Park Place Blvd. on-sale intoxicating & Sunday sales $8,950.00 Punch Neapolitan Pizza 5799 West 16th Street, Suite 100 on-sale wine & 3.2 $2,750.00 Raku Sushi & Lounge 5371 16th St W. on-sale intoxicating & Sunday sales $8,950.00 Rojo Mexican Grill 1602 West End Blvd on-sale intoxicating & Sunday sales $8,950.00 Sato Fusion 4224 Minnetonka Blvd. on-sale wine & 3.2 $2,750.00 St. Louis Park Liquor 6316 Minnetonka Blvd off-sale $380.00 Steel Toe Brewing 4848 35th Street W. brewer off-sale; taproom on-sale & Sunday sales $1,000.00 Target Store T-2189 8900 Highway 7 off-sale $380.00 Taste of India 5617 Wayzata Blvd on-sale wine & 3.2 $2,750.00 Texas-Tonka Liquor 8242 Minnetonka Blvd off-sale $380.00 Texa-Tonka Lanes 8200 Minnetonka Blvd on-sale intoxicating & Sunday sales $8,950.00 The Block Restaurant 7007 Walker St. on-sale intoxicating & Sunday sales $8,950.00 The Dampfwerk Distillery Co. 6311 Cambridge St. Micro distillery off-sale; cocktail room on-sale & Sunday sales $1,000.00 The Local - West End 1607 Park Place Blvd on-sale intoxicating & Sunday sales $8,950.00 The Loop 5331 16th Street W. on-sale intoxicating & Sunday sales $8,950.00 Top Ten Liquors 5111 Excelsior Blvd off-sale $380.00 Total Wine & More 8100 MN-7 off-sale $380.00 Trader Joe's #710 4500 Excelsior Blvd off-sale $380.00 Ullsperger Brewing, LLC 2314 Louisiana Avenue S. on-sale brewer’s taproom & off-sale brewer $600.00 Wells Roadside 3712 Quebec Ave S on-sale intoxicating & Sunday sales $8,950.00 Westside Wine & Spirits 8016 Minnetonka Blvd. off-sale $380.00 Westwood Liquors 2304 Louisiana Ave S off-sale $380.00 Wok in the Park 3005 Utah Ave South on-sale wine & 3.2 $2,750.00 Yangtze River Restaurant 5625 Wayzata Blvd on-sale wine & 3.2 $2,750.00 Yard House #8354 1665 Park Place Blvd. on-sale intoxicating & Sunday sales $8,950.00 Yum! Kitchen and Bakery 4000 Minnetonka Blvd. on-sale wine & 3.2 $2,750.00 Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5c Executive summary Title: Approve bid for removal of nuisance trees on public property for 2025 - 2026 Recommended action: Motion to designate Tree Trust as the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $162,680.20 for the removal of nuisance trees and stumps on public property for 2025 – 2026. Policy consideration: Does the city council wish to continue to remove nuisance trees on public property? Summary: At the Jan. 6, 2025 meeting, the city council approved advertising for bids to remove nuisance trees on public property. Emerald ash borer continues to impact ash trees in the city. Tree removals on public property using city contractors is expected to be similar or less than the previous contract, which was also a two-year contract. A total of five (5) bids were received for this project on Jan. 28, 2025. A summary of the bid results is shown below: Contractor Bid Amount Tree Trust $162,680.20 Pro-Tree Outdoor Services LLC $246,830.74 Precision Landscape and Tree $278,380.00 Shadywood Tree Experts $446,975.00 The Davey Tree Expert Co. $447,985.00 Staff recommend that a contract be awarded to Tree Trust in the amount of $162,680.20. Tree Trust is a city licensed tree contractor and the city has partnered with this organization on multiple projects. Removal of trees on public property is required for compliance with the city’s vegetation nuisance codes; primarily removal of dead, diseased, insect infested and hazard trees. Tree removal helps keep the public safe and reduces infection/infestation in healthy trees. Financial or budget considerations: Annual tree removal is included in the city’s budget, under the natural resources division. Strategic priority consideration: St. Louis Park is committed to continue to lead in environmental stewardship. Supporting documents: None Prepared by: Stacy M. Voelker, senior office assistant Reviewed by: Michael Bahe, natural resources manager Jason T. West, director of parks and recreation Approved by: Kim Keller, city manager Meeting: City council Meeting date: March 3, 2025 Consent agenda item: 5d Executive summary Title: Approve bid for removal of nuisance trees on private property for 2025 - 2026 Recommended action: Motion to designate Shadywood Tree Experts as the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $175,010 for the removal of nuisance trees on private property for two years, 2025 – 2026. Policy consideration: Does the city council wish to continue to remove nuisance trees on private property? Summary: At the Jan. 6, 2025 meeting, the city council approved advertising for bids to remove nuisance trees on private property. Quantities or removals are expected to be similar or reduced in comparison to the previous two-year contract, as many ash trees that have not been treated for emerald ash borer have already been removed. A total of two (2) bids were received for this project on Jan. 28, 2025. A summary of the bid results is shown below: Contractor Bid Amount Shadywood Tree Experts $175,010 Pro-Tree Outdoor Services LLC $180,738 Staff recommend that a contract be awarded to Shadywood Tree Experts in the amount of $175,010. Shadywood Tree Experts has successfully completed similar work for the city in the past. Removal of trees on private land is required for compliance with the city’s vegetation nuisance codes; primarily removal of diseased, insect infested and hazard trees. Tree removal helps keep the public safe and reduces infection/infestation in healthy tre es. When a tree is condemned on private property, the owners of the property have the option to utilize the city contract price with a 10% administrative fee (max. $500) or find their own city licensed contractor without a fee. The removal costs in the city contract are often lower than soliciting the work on their own. Financial or budget considerations: Annual tree removal is included in the city’s budget, under the natural resources division. Strategic priority consideration: St. Louis Park is committed to continue to lead in environmental stewardship. Supporting documents: None Prepared by: Stacy M. Voelker, senior office assistant Reviewed by: Michael Bahe, natural resources manager Jason T. West, director of parks and recreation Approved by: Kim Keller, city manager Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5e Executive summary Title: Approve replacement of zamboni (unit 1108) Recommended action: Motion to approve replacement of a zamboni (unit 1108). Policy consideration: Does the city council approve replacing the zamboni (unit 1108)? Summary: Our zamboni is 14-years old and scheduled to be replaced in the 2025 capital improvement plan. This type of equipment resurfaces the ice at the Rec Center. Staff evaluated the equipment based on age, condition and salvage value. It is recommended to be replaced as planned. The replacement will be driven by lithium-ion batteries, replacing the current propane-fueled unit. A quote for a zamboni was received in the amount of $181,892.50. The replacement will be purchased via the Sourcewell cooperative purchasing venture with Frank J. Zamboni & Co., Inc. Council approval is required because the purchase is over the statutory limit of $175,000. Financial or budget considerations: The replaced unit will be traded in or auctioned, and proceeds will go to the capital replacement fund. The budgeted cost of the new zamboni was $185,130 and the estimated replacement cost is $181,892.50. Strategic priority consideration: St. Louis Park is committed to creating opportunities to build social capital through community engagement. Supporting documents: None. Prepared by: Stacy M. Voelker, administrative coordinator Tom O’Donnell, fleet manager Reviewed by: Jason T. West, parks and recreation director Amelia Cruver, finance director Approved by: Kim Keller, city manager Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5f Executive summary Title: Approve replacement of Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V- plow (units 1924, 1924B and 1924P) Recommended action: Motion to approve the replacement of Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V-plow (units 1924, 1924B and 1924P). Policy consideration: Does the city council approve replacing the Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V-plow (units 1924, 1924B and 1924P)? Summary: Our Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V-plow is a ten-year-old tractor scheduled to be replaced in the 2025 capital improvement plan. This type of vehicle clears city sidewalks, walking paths and occasionally parking lots. Staff evaluated the equipment based on age, condition and salvage value. It is recommended to be replace d as planned. The replacement will be similar in type and use. A quote for a Trackless Sidewalk Tractor including a Sno-Quip Ribbon blower and V-plow, was received in the amount of $221,293.70. The replacement will be purchased via the State of Minnesota cooperative purchasing venture with MacQueen Equipment. Council approval is required because the purchase is over the statutory limit of $175,000. Financial or budget considerations: The replaced unit will be traded in or auctioned, and proceeds will go to the capital replacement fund. The budgeted cost of the Trackless Sidewalk Tractor with Sno-Quip Ribbon blower and V-plow was $167,327 and the estimated replacement cost is $221,293.70. Strategic priority consideration: St. Louis Park is committed to providing a variety of options for people to make their way around the city comfortably, safely and reliably. Supporting documents: None. Prepared by: Stacy M. Voelker, administrative coordinator Tom O’Donnell, fleet manager Reviewed by: Jason T. West, parks and recreation director Amelia Cruver, finance director Approved by: Kim Keller, city manager Meeting: City council Meeting date: February 3, 2025 Consent agenda item: 5g Executive summary Title: Resolution authorizing special assessment for water service line repair at 5922 Excelsior Boulevard - Ward 2 Recommended action: Motion to adopt a resolution authorizing the special assessment for the repair of the water service line at 5922 Excelsior Boulevard, St. Louis Park, MN. P.I.D. 21-117-21-23-0010. Policy consideration: The proposed action is consistent with a policy previously established by the city council. Summary: Thomas Rosen, owner of 5922 Building LLC, located at 5922 Excelsior Boulevard, has requested the city authorize the repair of the water service line for his commercial property and assess the cost against the property in accordance with the city’s special assessment policy. The city requires the repair of service lines to promote the general public health, safety and welfare within the community. The special assessment policy for the repair or replacement of water and/or sewer service lines for existing homes and commercial properties was adopted by the city council in 1996. This program was put into place because sometimes property owners face financial hardships when emergency repairs like this are unexpectedly required. Plans and permits for this service line repair work were completed, submitted, and approved by city staff. The property owner hired a contractor and repaired the water service line in compliance with current codes and regulations. Based on the completed work, this repair qualifies for the city’s special assessment program. The property owner has petitioned the city to authorize the water service line repair and special assess the cost of the repair. The total eligible cost of the repair has been determined to be $45,145.62. Financial or budget considerations: The city has funds in place to finance the cost of this special assessment. Strategic priority consideration: St. Louis Park is committed to continue to lead in environmental stewardship. Supporting documents: Resolution Prepared by: Beth Holida, office assistant Stacy M. Voelker, administrative coordinator Reviewed by: Emily Carr, assessing technician Austin Holm, utilities superintendent Jay Hall, public works director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 5g) Page 2 Title: Resolution authorizing special assessment for water service line repair at 5922 Excelsior Boulevard - Ward 2 Resolution No. 25-____ Authorizing the special assessment for the repair of the water service line at 5922 Excelsior Boulevard, St. Louis Park, MN P.I.D. 21-117-21-23-0010 Whereas, the property owner at 5922 Excelsior Boulevard, has petitioned the City of St. Louis Park to authorize a special assessment for the repair of the water service line for the commercial property located at 5922 Excelsior Boulevard; and Whereas, the property owner has agreed to waive the right to a public hearing, right of notice and right of appeal pursuant to Minnesota Statute, Chapter 429; and Whereas, the city council of the City of St. Louis Park has received a report from the Utility Superintendent related to the repair of the water service line. Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota, that: 1. The petition from the property owner requesting approval and special assessment for the water service line repair is hereby accepted. 2. The water service line repair that was done in conformance with the plans and specifications approved by the public works department and department of inspections is hereby accepted. 3. The total cost for the repair of the water service line is accepted at $45,145.62. 4. The property owner has agreed to waive the right to a public hearing, notice and appeal from the special assessment, whether provided by Minnesota Statutes, Chapter 429, or by other statutes, or by ordinance, City Charter, the constitution, or common law. 5. The property owner has agreed to pay the city for the total cost of the above improvements through a special assessment over a ten (10) year period at the interest rate of 5.5%. 6. The property owner has executed an agreement with the city and all other documents necessary to implement the repair of the water service line and the special assessment of all costs associated therewith. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk Meeting: City council Meeting date: February 3, 2025 Public hearing: 6a Executive summary Title: Public hearing for on-sale cocktail room and off-sale microdistillery liquor licenses Recommended action: Mayor to open public hearing, take public testimony, and close public hearing. Motion to approve application from Hennepin Distilling, LLC dba Copperwing Distillery, for on-sale cocktail room and off-sale microdistillery liquor licenses for the premises located at 6409 Cambridge Street, with a license term through Feb. 28, 2026. Policy consideration: Does the applicant meet the requirements for the issuance of on-sale cocktail room and off-sale microdistillery liquor licenses for Hennepin Distilling, LLC? Summary: Hennepin Distilling, LLC dba Copperwing Distillery, notified the city of a change in business ownership that also requires a new Minnesota Tax ID. The Minnesota Department of Public Safety’s Alcohol and Gambling Enforcement division instructed the business owner , Kyle Kettering, to apply for and obtain a new license at both the city and state levels. St. Louis Park city code section 3-69 requires changes in ownership to be approved by the city council. The city received an application from Hennepin Distilling, LLC dba Copperwing Distillery, for an on-sale cocktail room and off-sale microdistillery liquor license for the property located at 6409 Cambridge Street. The primary change is that the business will now be a sole proprietorship, owned by Kyle Kettering, who is also responsible for daily operations. The location and operation of the business remains unchanged; Hennepin Distilling is a microdistillery licensed by the State of Minnesota to produce less than 40,000 proof gallons of alcohol per year. The cocktail room is approximately 600 square feet in size with seating for 40 guests. The police department conducted a full background investigation, and nothing was discovered during the course of the investigation that would warrant denial of the license. The application and police report are on file in the city clerk’s office. The required notice of public hearing was published on Jan. 23, 2025. Financial or budget considerations: Fees for this applicant include $600 for the on-sale cocktail room license and $200 for the off-sale microdistillery license. Strategic priority consideration: Not applicable. Supporting documents: None. Prepared by: Amanda Scott-Lerdal, deputy city clerk Reviewed by: Melissa Kennedy, city clerk Approved by: Kim Keller, city manager Meeting: City council Meeting date: February 3, 2025 Public hearing: 6b Executive summary Title: Public hearing on establishment of the Terasă TIF District – Ward 4 Recommended action: No formal action. Mayor to open the public hearing, take testimony, and close the hearing. Policy consideration: Does the city council wish to establish the Terasă Tax Increment Financing (TIF) District to create the funding mechanism for providing tax increment financing assistance to the proposed Terasă redevelopment? Summary: Hempel Real Estate (“redeveloper”) proposes to remove the current office building at 5401 Gamble Drive and construct Terasă, a six-story, 223-unit mixed-use, mixed income apartment building with approximately 21,000 square feet of ground floor retail space. The redeveloper proposes 45 affordable housing units (20% of the total) for households earning up to 50% of area median income (AMI) for 26 years, exceeding the city’s Inclusionary Housing Policy requirements. Additionally, Hempel has agreed to make six of the affordable housing units available to households earning up to 30% of AMI, contingent on approval of a request for six project-based vouchers from the city’s Housing Authority Board. The EDA and city council received an outline of Hempel’s request for financial assistance, including how the redevelopment meets or exceeds city policies, on Nov. 18, 2024 and a summary of business terms related to the proposed financial assistance on Dec. 16, 2024. State law requires the city council to hold a public hearing prior to the establishment of any tax increment financing districts. This public hearing is the next step in the consideration process. Financial or budget considerations: The redeveloper has applied for public financial assistance to help offset a gap in its financial proforma that prevents its proposed Terasă development from achieving a market rate of return sufficient to attract financing. Subsequently, Ehlers, the EDA’s financial consultant, determined that up to $6.54 million in financial assistance is warranted to enable the $91.7 million project to achieve a market rate of return and sustain itself over time. Such assistance is proposed to be provided via a $5.54 million pay-as-you-go TIF Note and a $1 million deferred loan from the Affordable Housing Trust Fund (AHTF). Given current market value estimates, the TIF Note is anticipated to be repaid in approximately 11 years. The AHTF loan would be repaid in a bulk sum, with interest, at year 11. Hempel will also request six project-based vouchers from the city’s Housing Authority Board to facilitate the inclusion of six (6) deeply affordable units in the development. On Feb. 18, 2025, the EDA and city council will be asked to consider the establishment of a new housing TIF district (the funding mechanism for the financial assistance) and enter into a contract for private development with Hempel specifying the responsibilities of the respective parties and the financial assistance. Staff requests the council relay any questions to staff at their earliest convenience to allow sufficient time for response ahead of the formal action. Strategic priority consideration: St. Louis Park is committed to providing a broad range of housing and neighborhood oriented development. Supporting documents: Schedule; Terasă TIF District Summary Prepared by: Jennifer Monson, redevelopment admin., Keith Dahl, municipal advisor, Ehlers Reviewed by: Greg Hunt, economic development manager Karen Barton, community development director, EDA executive director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 6b) Page 2 Title: Public hearing on establishment of the Terasă TIF District – Ward 4 Schedule Previous actions Governing body Date EDA/council received a report outlining the redeveloper’s proposal for 5401 Gamble Drive. EDA/City council Aug. 12, 2024 EDA/council discussed the redeveloper’s proposal for 5401 Gamble Drive during a special study session. EDA/City council Aug. 19, 2024 EDA/council received report with updates of the redeveloper’s proposal for 5401 Gamble Drive. EDA/City council Sept. 9, 2024 EDA received a report outlining the redeveloper’s application for financial assistance and the recommended level of financial assistance. EDA Nov. 18, 2024 City council approved the resolution authorizing the distribution of an EAW for public review and comment City council Nov. 18, 2024 Consideration of park and trail dedication fees in lieu of park and trail land. Parks and Recreation Advisory Commission Dec. 4, 2024 EDA received a report outlining the business terms related to financial assistance and the contract for private development EDA Dec. 16, 2024 Public hearing and recommendation related to Hempel’s application for a preliminary and final PUD. Planning Commission Jan. 15, 2025 Environmental Assessment Worksheet finding of fact and negative declaration related to the redevelopment. City council Jan. 21, 2025 Future actions Governing body Date City council holds a public hearing on the establishment of the Terasa TIF District. City council Feb. 3, 2025 City council holds first reading of an Ordinance establishing the Terasă Planned Unit Development. City council Feb. 3, 2025 EDA considers the resolution adopting the Terasă TIF District Plan, establishing the Terasă TIF District, and the Contract for Private Development. EDA Feb. 18, 2025 City council considers a resolution approving the Terasă TIF District Plan and the Contract for Private Development. City council Feb. 18, 2025 City council holds second reading of an Ordinance establishing the Terasă Planned Unit Development. City council Feb. 18, 2025 • • City council meeting of February 3, 2025 (Item No. 6b) Title: Public hearing on establishment of the Terasă TIF District - Ward 4 Page 3 City of St. Louis Park Terasa TIF District 2 • • • • City council meeting of February 3, 2025 (Item No. 6b) Title: Public hearing on establishment of the Terasă TIF District - Ward 4 Page 4 City of St. Louis Park Terasa TIF District 3 City council meeting of February 3, 2025 (Item No. 6b) Title: Public hearing on establishment of the Terasă TIF District - Ward 4 Page 5 City of St. Louis Park Terasa TIF District 4 City council meeting of February 3, 2025 (Item No. 6b) Title: Public hearing on establishment of the Terasă TIF District - Ward 4 Page 6 Meeting: City council Meeting date: February 3, 2025 Action agenda item: 7a Executive summary Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Recommended action: • Motion to adopt resolution amending the special permit for West End Office Park, established via Resolution No. 5404 and previously amended via Resolution No. 20-192; and • Motion to adopt resolution approving a conditional use permit allowing shared parking facilities for 5353 Gamble Drive to be located on 1660 Highway 100 South • Motion to approve first reading of ordinance adding section 36-268-PUD 25 to the zoning code and amending the zoning map from O – office to PUD 25 and set the second reading for Feb. 18, 2025; and Policy consideration: Does city council support the proposed development? Summary: Hempel Real Estate applied for a planned unit development (PUD) at 5401 Gamble Dr. The applicant proposes a six (6)-story mixed-use redevelopment, Terasă, that will feature 223 residential units situated above approximately 21,000 square feet of commercial and retail space. It will be complemented by 133 surface parking stalls and 231 below-grade parking spaces to support both residents and visitors. In order to facilitate the PUD redevelopment, additional zoning approvals are required. The project proposes to amend the special permit that currently pertains to 5353 Gamble Dr., 5401 Gamble Dr., 5354 Parkdale Dr., and 5402 Parkdale Dr.; the amendment will remove 5401 Gamble Dr. and 5402 Parkdale Dr. from the special permit. The conditional use permit application is to allow off-site parking and shared parking agreements for the properties at 5353 Gamble Dr. and 1660 Highway 100 S. Financial or budget considerations: The applicant has applied to the Economic Development Authority (EDA) for an application for tax increment financing assistance. Strategic priority consideration: St. Louis Park is committed to providing a broad range of housing and neighborhood oriented development. Supporting documents: Special permit amendment resolution, shared parking CUP resolution, PUD ordinance, draft planning commission minutes from Jan. 15, 2025, zoning map amendment exhibit, official exhibits, site renderings, applicant narrative, draft travel demand management plan Prepared by: Laura Chamberlain, senior planner Reviewed by: Sean Walther, planning manager/deputy community development director Karen Barton, community development director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 7a) Page 2 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Discussion Site Information The proposed redevelopment site is at 5401 Gamble Dr., on the southeast corner of Park Place Boulevard and Gamble Drive, immediately south of the Shops at West End. It is in the Blackstone neighborhood. The redevelopment is proposed on one of four properties located within the current West End Office Park. It is one part of a previous special permit from when the office park was built. In order for the redevelopment to occur on 5401 Gamble Dr., additional approvals that apply to all four parcels are required and are included within this staff report. Site area (acres): 5401 Gamble Dr: 3.31 ac 5402 Parkdale Dr: 2.56 ac 5353 Gamble Dr: 2.12 ac 5354 Parkdale Dr: 1.73 ac Surrounding land uses North: The Shops at West End East: West End Office Park South: West End Office Park West: Retail, strip mall, gas station Current use: Office Proposed uses: Mixed-use, office Current 2024 land use guidance OFC - office Current zoning O office district TDM travel demand management overlay Proposed 2040 land use guidance OFC – office Proposed zoning PUD planned unit development TDM travel demand management overlay Gamble Drive Park Place Boulevard 1660 Hwy 100 S City council meeting of February 3, 2025 (Item No. 7a) Page 3 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Background In 2023, Eden Prairie-based Hempel Real Estate purchased the Shops at West End. Since its purchase, Hempel has further invested in the property, invigorating the shopping area by attracting new commercial, service and office tenants. Hempel would like to pursue further development immediately to the south of The Shops at West End to generate increased shopping activity in the area and activate the south end of the shopping area. Such activity would be spearheaded by additional residential units and commercial space, drawing more people to the area throughout the day, not just during typical office working hours. Previous Approvals The property was previously developed as part of the West End Office Park. The four properties within the office park were approved as part of the development via a special permit in 1975. The special permit was established by Resolution No. 5404 to “allow for an industrial development unit of four office buildings located in the I-2 Industrial District.” The special permit applies to the four properties that make up the West End Office Park: • 5401 Gamble Dr. • 5402 Parkdale Dr. • 5353 Gamble Dr. • 5354 Parkdale Dr. In 2020, the special permit was amended by Resolution No. 20-192 to allow changes to the courtyard central to all four office buildings and located on 5401 Gamble Dr., as well as add a pedestrian connection north to Gamble Drive from the center of the site. While the landscaping and courtyard changes occurred, the ADA accessible pedestrian walkway was never installed. Hempel Real Estate has a purchase agreement with Bridge Investment Group, the current owner, to purchase 5401 Gamble Dr. and 5402 Parkdale Dr. In order to redevelop 5401 Gamble Dr., and 5402 Parkdale Dr. in the future, the applicant requests that the special permit be amended to remove these two properties from the special permit. Although 5402 Parkdale Dr. is not being considered for any other approvals at this time, removing it from the special permit does not create any non-conforming uses. The property is currently zoned O – office, and office uses are permitted with conditions. Environmental assessment In November 2024, the city council approved the publication of an environmental assessment worksheet (EAW), which analyzes the impact of the proposed development at 5401 Gamble Dr., as well as potential future development of the remaining three parcels of West End Office Park. On Jan. 21, 2025, the city council approved a resolution declaring that further environmental review is not needed. Present considerations: The applicant requests the city: 1. Approve an amendment to the special permit established by Resolution No. 5404 and previously amended by Resolution No. 20-192; the amendment will remove 5401 Gamble Dr. and 5402 Parkdale Dr. from the special permit, leaving 5353 Gamble Dr. and 5354 Parkdale Dr. under the special permit. City council meeting of February 3, 2025 (Item No. 7a) Page 4 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 2. Approve an amendment to the zoning ordinance to create PUD-25 planned unit development and approve an amendment to the zoning map to rezone 5401 Gamble Dr. from O – office to PUD-25 planned unit development. 3. Approve a conditional use permit (CUP) allowing 5353 Gamble Dr. to have 15 of its required off-street parking spaces to be off-site at 1660 Highway 100 S, which has more parking than the minimum required by the zoning ordinance. Architectural site plan Planned unit development analysis Description and site plan The developer requests approval of a preliminary and a final planned unit development (PUD). A PUD is a rezoning and zoning text amendment that establishes the regulations for a specific property. The site is currently zoned O – office. City council meeting of February 3, 2025 (Item No. 7a) Page 5 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Building and site design analysis The Terasă redevelopment meets the PUD ordinance goals for building and site design. The ordinance requires the city to find that the quality of building and site design proposed will substantially enhance aesthetics of the site and implement relevant goals and policies of the Comprehensive Plan. In addition, the following criteria shall be satisfied: (1) The design shall consider the project as a whole and shall create a unified environment within project boundaries by ensuring architectural compatibility of all structures, efficient vehicular and pedestrian circulation, aesthetically pleasing landscape and site features, and design and efficient use of utilities. Staff finds the plan meets this requirement. (2) The design of a PUD shall achieve compatibility of the project with surrounding land uses, both existing and proposed, and shall minimize the potential adverse impacts of the PUD on surrounding land uses and the potential adverse effects of the surrounding land uses on the PUD. Staff finds these criteria will be met. (3) A PUD shall comply with the City’s Green Building Policy. This criterion will be met. The development intends to use LEED Silver certification to meet the requirements of the policy. City council meeting of February 3, 2025 (Item No. 7a) Page 6 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 (4) The use of green roofs or white roofs and on-site renewable energy is encouraged. The building includes rooftop solar energy installation. This criterion will be met. (5) A PUD shall comply with the city’s Inclusionary Housing Policy. The proposed development would double the city’s inclusionary housing policy requirements by providing 39 units (17%) available to households earning up to 50% of area median income (AMI) for 26 years and 6 units (2.7%) available to households at 30% AMI. This criterion will be met. Zoning analysis The following table provides the development’s metrics. The proposed performance and development standards, as indicated in the development, establish the development requirements for this property if approved. Factor Required Proposed Met? Uses PUD can establish Mixed-use Multi-unit dwelling residential Retail Restaurant (with or without liquor) In-vehicle services Yes Dimensional Standards & Densities Min. Lot Area PUD minimum is 2.0 acres 3.31 acres Yes Floor Area Ratio PUD can establish Floor area: 318,533 square feet Lot area: 144,378 square feet FAR: 2.21 Yes Dwelling Units n/a 223 dwelling units Studio units: 74 1-BR units: 71 2-BR units: 71 3-BR units: 7 Yes Density (units per acre) Comprehensive Plan: Office land use: 50-125 units/acre 67.4 units/acre Yes Building Height PUD can establish 6 stories – 80.75 feet Yes Setbacks PUD can establish North (Gamble Dr.): 11.0 feet East: 22.4 feet South: 59.2 feet West (Park Place Blvd.): 16.3 feet Yes City council meeting of February 3, 2025 (Item No. 7a) Page 7 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Factor Required Proposed Met? Off-Street Parking Vehicle Parking Multi-family: 279 spaces Commercial: 107 spaces Transit reduction (-10%): -39 spaces Required vehicle parking: 347 spaces Surface: 133 spaces Garage: 231 spaces Total: 364 spaces Yes EV Parking The Green Building Policy has requirements in addition to the zoning requirements 31 EV spaces (at least 2 ADA) 183 EV-Ready spaces ^ of the above, the following need to be on the surface lot: 8 EV spaces (at least 2 ADA) 67 EV-Ready spaces Surface: EV Total: 8 EV Standard: 6 EV ADA: 2 EV Ready: 67 Garage: EV Total: 23 EV Standard: 23 EV ADA: 0 EV Ready: 116 Total: EV Total: 31 EV Standard: 29 EV ADA: 2 EV Ready: 183 Yes Bicycle Parking Multi-family: 248 spaces Commercial: 10 spaces Required bike parking: 258 spaces Exterior: 35 racks, 70 spaces Indoor: 188 wall mounts, 188 spaces Total: 258 parking spaces Yes Landscaping Minimum Landscaping Tree requirement: 244 canopy trees Shrub requirement: 1,911 shrubs Tree count Canopy: 83 trees Ornamental: 4 trees Shrub count: 342 shrubs Alternative landscaping: public art, public seating, outdoor plaza, transit shelter Yes Screening Landscaping None required Screening wall between the drive through and Park Place Blvd Yes City council meeting of February 3, 2025 (Item No. 7a) Page 8 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Factor Required Proposed Met? Off-Street parking areas landscaping and screening Islands with canopy trees every 15 spaces The open-air portion of the surface parking lot has landscaped islands Yes Tree removal / replacement Diameter inches on site: 778 Diameter inches removed: 727 Tree replacement: 857 inches Proposed: 83 trees at 180 caliper inches Remainder: 677 inches at $225 per inch Fee-in-lieu: $152,347 Yes Open Area/ DORA 12% of lot area; 17,325 square feet Terraces: 21,933 square feet Other spaces: 13,069 square feet Total on-site: 35,002 square feet = 24% Additional off-site green open space: 19,555 square feet Yes Architectural design Wall Deviations 2:1 max The deviations between different floors, and with the balconies meets this requirement Yes Building Materials Class 1: 60% min faces visible off-site Class 3: 10% max Face Class 1 Class 2 Class 3 Visible off site? Yes North 70% 30% 0% Y East 68% 32% 0% Y South 60% 40% 0% Y West 69% 31% 0% Y Ground Floor Transparency 50% on street-facing elevations North: 21.3% - does not include see-through screens on parking area, which bring them into compliance West: 50% Yes Mechanical Equipment Inside or located on roof where it is fully screened Inside or located on roof where it is fully screened Mechanical equipment next to bus shelter will be screened by landscaping Yes Shadowing Does not exceed 50% for more than 2 hours Does not exceed 50% for more than 2 hours Yes City council meeting of February 3, 2025 (Item No. 7a) Page 9 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Uses: The project is a single-phased mixed-use development with one six-story building. The ground floor has commercial uses including a grocery store, restaurants, in-vehicle services (drive- through) and retail. The upper floors are multi-unit residential dwellings. This includes a combination of one-, two- and three-bedroom units. Amenities for residents include terraces with lounge areas and a pool, a fitness room and underground parking. Unit Type Number of Units Number of Bedrooms Studio 74 units 74 bedrooms One-bedroom 71 units 71 bedrooms Two-bedroom 71 units 142 bedrooms Three-bedroom 7 units 21 bedrooms Total 223 units 294 bedrooms Landscaping: Minimum planting requirements for the project require 244 canopy trees and 1,911 shrubs for landscaping. The developer proposes to utilize alternative landscaping methods highlighted within the zoning ordinance, including public seating, outdoor plaza, transit shelter and potentially public art. Staff find the project meets landscaping requirements. Tree replacement: The proposed development will remove 727 caliper inches of significant trees during construction out of a total of 778 caliper inches of significant trees currently on the site. The project proposes 83 canopy trees to be planted, resulting in 180 caliper inches. The remaining 677 inches will need to be replaced as fee-in-lieu, resulting in a tree replacement fee of $152,325. Staff find with the payment of the fee, the project will meet tree replacement requirements. Designed outdoor recreation area (DORA): There is no minimum DORA requirement for PUDs, but other zoning districts generally require 12% DORA. The proposed plans have 24% of the site area designated as DORA, mostly accomplished through amenity terraces accessible to the residents of Terasă. Amenities include a pool, grilling areas, lounge furniture and corresponding interior lounge areas. In addition to these on-site amenities, the developer proposes building an approximately 20,000 square foot green open space on the adjacent property at 5353 Gamble Dr. Staff find the project meets DORA requirements. Travel demand management overlay district The project site is located within the city’s travel demand management (TDM) overlay zoning district. The TDM overlay was established to monitor vehicle traffic demand around the Interstate 394 and Highway 100 interchange, in particular for peak traffic caused by office uses. The City of St. Louis Park coordinates the TDM overlay along with a similar district with the City of Golden Valley. The developer is required to create a travel demand management plan, which will need to be reviewed and approved by a joint task force made up of St. Louis Park and Golden Valley city officials and city staff. City council meeting of February 3, 2025 (Item No. 7a) Page 10 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 The applicant has submitted a draft TDM plan with strategies to reduce vehicle traffic resulting from the development. Staff finds that with approval of the TDM plan by the joint task force, this project will meet TDM requirements. Inclusionary housing policy The proposed development is double the city’s inclusionary housing policy requirements and will increase the number of existing affordable units in the West End by over 300% by providing 39 units (17%) available to households earning up to 50% of area median income (AMI) for 26 years and 6 units (2.7%) available to households at 30% AMI. The redeveloper intends to apply for tax increment financing to help offset a portion of the site’s extraordinary costs in order to fill the financial gap in the project’s proforma. The site qualifies for a Housing TIF district, which requires 20% of the units to be affordable to households earning up to 50% AMI or 40% of the units be affordable to households earning up to 60% AMI. The plans also include seven three-bedroom units to assist in meeting the city council’s goals for family-sized housing. Staff have worked with the redeveloper to include six 30% AMI units in the development, via project-based vouchers to provide more deeply affordable housing options. Unit Type Market Rate 50% AMI units 30% AMI units (Project- Based Vouchers*) Total Units Percent of total units Studio 60 17 0 77 35% 1-bedroom 57 14 0 71 32% 2-bedroom 55 8 5 68 30% 3-bedroom 6 0 1 7 3% Total 178 39 6 223 100% Green building policy: The development will adhere to the city’s green building policy as amended in early 2023 and intends to follow LEED Silver certification as its design rating system. The development will also include the following sustainable features: • LED lighting, • Low VOC materials, • Construction waste recycling, • Higher efficiency HVAC systems, • Low flow fixtures, and • Recycled content materials The building is also proposed to have a 40kw rooftop solar array. Special permit amendment analysis To redevelop the property at 5401 Gamble Dr. the applicant requests that the existing special permit that covers all four of the existing West End Office Park properties be amended to City council meeting of February 3, 2025 (Item No. 7a) Page 11 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 remove 5401 Gamble Dr. and 5402 Parkdale Dr. from the special permit. 5353 Gamble Dr. and 5354 Parkdale Dr. Would remain under the amended special permit. Bridge Investment Group wants 5353 Gamble Drive and 5354 Parkdale Drive to remain covered by the amended special permit, as proposed in the application. The special permit official exhibits accompanying the special permit will be updated to reflect the changes proposed. Conditional use permit analysis As a part of the redevelopment of 5401 Gamble Dr., the redeveloper has proposed a green open space to be located on 5353 Gamble Dr., in partnership with current owner, Bridge. The construction of the proposed green open space will remove a portion of the existing parking lot on 5353 Gamble Dr. As a result, the property no longer has enough on-site parking to meet zoning requirements. The owner, Bridge, has elected to enter into a shared parking agreement with the property directly to the east, 1660 Highway 100 S, which they also own. Shared parking agreements are allowed via a conditional use permit. Staff finds the application meets the following general requirements for conditional use permits listed in city code section 36-33(b) and the conditions listed in city code section Sec. 36-361(h), which are specific to shared off-street parking facilities located in any zoning district. These have been reflected in the findings and conditions of the attached resolution. Neighborhood meeting The applicant held a neighborhood meeting on Dec. 17, 2024. Employees of two neighboring building attended the meeting. They had questions about timing of the project and the status City council meeting of February 3, 2025 (Item No. 7a) Page 12 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 of community events that happen on Gamble Drive. They also supported having more residents in the area along with more retail options. Planning commission and public hearing The planning commission held a public hearing for the applications on Jan. 15, 2025. There were no members of the public present. The planning commission had a number of questions about the project, relating to residential affordability, site circulation and development considerations for users of the site who do not drive a personal vehicle. Specific concerns were raised about maintaining the primary entrance at the corner of Gamble Drive and Park Place Boulevard for the grocer, as well as the need for more internal crosswalks to allow for pedestrian circulation throughout the site. The commission voted unanimously to recommend approval of the three requested applications associated with this project, with conditions. The draft meeting minutes are attached for review. Recommendations: Special permit amendment The planning commission and city staff recommend approval of the resolution amending the special permit pertaining to West End Office Park subject to the conditions included in the amending resolution. Conditional use permit The planning commission and city staff recommend approval of the resolution allowing for a conditional use permit to allow for shared parking from 5353 Gamble Drive to be on 1660 Highway 100 South, subject to the conditions included in the resolution. Planned unit development The planning commission and city staff recommend approval of the preliminary and final planned unit development for the Terasă Development subject to the following conditions:. 1. The site shall be developed, used and maintained in accordance with the conditions of this ordinance, approved official exhibits, and city code. 2. All utility service structures shall be buried. If any utility service structure cannot be buried (i.e. electric transformer), it shall be integrated into the building design and 100% screened from off-site with materials consistent with the primary façade materials. 3. Prior to starting any land disturbing activities, the following conditions shall be met: a. A preconstruction meeting shall be held with the appropriate development, construction, private utility, and city representatives. b. All necessary permits shall be obtained. 4. Prior to issuance of building permits, the following conditions shall be met: a. A planning development contract shall be executed between the developer and city that addresses, at a minimum: i. The conditions of PUD approval as applicable or appropriate. ii. Alternative landscaping requirements and tree replacement fees. City council meeting of February 3, 2025 (Item No. 7a) Page 13 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 iii. The installation of all public improvements including, but not limited to, sidewalks, trails, boulevards and the execution of necessary easements related to such improvements. iv. Easements related to electronic communication and fiber infrastructure. v. A performance guarantee in the form of cash escrow or irrevocable letter of credit shall be provided to the City of St. Louis Park in the amount of 1.25 times of the costs of all public improvements (sidewalks and boulevards), and the private site stormwater management system and landscaping. vi. The developer shall reimburse city attorney’s fees in drafting/reviewing such documents as required in the final PUD approval. i. The mayor and city manager are authorized to execute said planning development contract. b. Final construction plans for all public improvements and private stormwater system shall be signed by a registered engineer and submitted to the city engineer for review and approval. c. Building material samples and colors shall be submitted to the city for review and approval. 5. The developer shall comply with the following conditions during construction: a. All city noise ordinances shall be complied with, including that there be no construction activity between the hours of 10 p.m. and 7 a.m. Monday through Friday, and between 10 p.m. and 9 a.m. on weekends and holidays. b. The site shall be kept free of dust and debris that could blow onto neighboring properties. c. Public streets shall be maintained free of dirt and shall be cleaned as necessary. d. The city shall be contacted a minimum of 72 hours prior to any work in a public street. e. Work in a public street shall take place only upon the determination by the city engineer (or designee) that appropriate safety measures have been taken to ensure motorist and pedestrian safety. f. The developer shall install and maintain chain link security fencing that is at least six feet tall along the perimeter of the site. All gates and access points shall be locked during non-working hours. g. Temporary electric power connections shall not adversely impact surrounding neighborhood service. 6. Prior to the issuance of any permanent certificate of occupancy permit the following shall be completed: a. A travel demand management plan shall be approved by a joint task force in compliance with the Travel Demand Management overlay zoning district, as described in Article IV, Division 12 of the zoning ordinance. b. Public improvements, private utilities, site landscaping and irrigation, and storm water management system shall be installed in accordance with the official exhibits. City council meeting of February 3, 2025 (Item No. 7a) Page 14 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 7. All mechanical equipment shall be fully screened. Rooftop equipment may be located as indicated in the official exhibits so as not to be visible from off-site. 8. The materials used in, and placement of, all signs shall be integrated with the building design and architecture. City council meeting of February 3, 2025 (Item No. 7a) Page 15 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Resolution No. 25-__ Amends and Restates Resolution No. 20-192 Granting permit under Section 6:176.3 of the zoning ordinance to provide for an industrial development unit of four office building located in the I-2 industrial district on property bounded by Gamble Drive, Vernon Avenue, Cedar Lake Road and the Burlington Northern Spur Track Be it resolved by the city council of the City of St. Louis Park: Findings Whereas, Hempel Real Estate, on behalf of the owner, BOF II MN West End Office Park LLC, has made application to the city council for an amendment to an existing special permit under Section 36-37 of the St. Louis Park Ordinance Code to allow for the removal of 5401 Gamble Drive and 5402 Parkdale Drive to be removed from the special permit, and allowing for 5353 Gamble Drive and 5354 Parkdale Drive to continue to be within the special permit; the properties have the legal descriptions, as listed within Exhibit I; and Whereas, the city council has considered the information related to Planning Case Nos. 75-62-SP and 20-14-SP and the effect of the proposed changes to the special permit on the health, safety, and welfare of the occupants of the surrounding lands, existing and anticipated traffic conditions, the effect on values of properties in the surrounding area and the effect of the use on the Comprehensive Plan; and compliance with the intent of the Zoning Ordinance; and Whereas, it is the intent of this resolution to amend the conditions of the permit granted by Resolution No. 5404, as previously amended by Resolution No. 20-192, to remove the properties of 5401 Gamble Drive and 5402 Parkdale Drive from the special permit and to update official exhibits to reflect those changes; and Whereas, the contents of Case Nos. 24-28-PUD, 24-29-SP, and 24-30-CUP, are hereby entered into and made part of the public hearing record and the record of decision for this case, Conclusion The special permit to permit an Industrial Development Unit consisting of four two office buildings is granted based on the findings set forth above and subject to the following conditions: 1. The site be developed, used, and maintained in accordance with Exhibit “A,” Survey; Exhibit “B,” Site Plan; Exhibits “C,” Landscape Plan; Exhibit “D,” Ground Floor and Elevations; Exhibit “E,” First Floor and Side Elevations; Exhibit “F,” Second Floor and Side Elevation; Exhibit “G,” Phase I Development Plan; except as modified by the following conditions: City council meeting of February 3, 2025 (Item No. 7a) Page 16 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 a. A Utilities Plan shall be prepared for the entire site which shall be labeled Exhibit “H,” Utilities Plan, and said plan shall be approved by the Director of Public Works before any building permits are issued for the site as described above. b. The roof top equipment penthouse shall be completed with metal insulating panels identified as INRYCO wall system IW-31A. c. Pedestrian access shall be provided from the central courtyard area to Gamble Drive and to Cedar Lake Road to facilitate drop off and access to other areas within the development area. d. Signs shall be restricted to name-plate signs properly integrated within the architectural context of the building. e. The use of the site shall be limited to not more than 170,000 square feet of office and 17,000 square feet of retail sales and service. f. All construction, buildings, parking areas, landscaping, lighting, pedestrian facilities, and plazas shall be completed by December 1, 1979. 2. The special permit shall be amended on September 8, 2020 to incorporate all of the preceding conditions and the following conditions: a. The site shall be developed, used and maintained in accordance with the Official Exhibits incorporated by reference herein. b. Prior to any site work, applicant shall meet the following conditions: i. Applicant shall sign assent form and official exhibits. ii. All required permits shall be obtained prior to starting construction, including but not limited to: 1. NPDES Grading/Construction Permit. 2. City of St. Louis Park Erosion Control and Building Permits 3. A stormwater management permit from the Minnehaha Creek Watershed District. iii. The applicant shall provide to the city a financial guarantee in the form of a Letter of Credit or Cash Escrow to ensure the installation and survival of all landscaping materials. The financial guarantee shall be in the amount of 125% of the cost of the landscaping materials and installation. Upon installation, 25% will be reserved for a warranty period of one year to guarantee the survival of the trees and plantings. c. A building permit is required, which may impose additional conditions. 3. The special permit shall be amended on February 3, 2025 to incorporate all of the preceding conditions and the following conditions: a. The amendment shall be conditional upon the approval of the rezoning of 5401 Gamble Dr. to PUD, as approved by Ordinance No. XX-25. b. The amendment shall be conditional upon the approval of a conditional use permit for shared parking for 5353 Gamble Dr, as approved by Resolution No. 25-XX. c. The properties at 5401 Gamble Drive and 5402 Parkdale Drive, as legally described in Exhibit “I,” shall be removed from the special permit; the properties at 5353 Gamble Drive and 5354 Parkdale Drive, as legally described in Exhibit “I,” shall remain under the approvals of this special permit; the site plan shall be updated to align with Exhibit “II.” City council meeting of February 3, 2025 (Item No. 7a) Page 17 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 d. The new green space at 5353 Gamble Drive shall be constructed and maintained as part of the redevelopment proposed for 5401 Gamble Drive, as approved by Ordinance No. XX-25. i. The properties of 5401 Gamble Drive, 5402 Parkdale Drive, 5353 Gamble Drive, and 5354 Parkdale Drive shall enter into an agreement for the green space that: 1. Allows users of all four sites to have access to the new green space. 2. Assigns management and maintenance responsibilities among the parties to the agreement. 3. Allows for public access and use of the space on an equal basis to owners and tenants of the properties. 4. The form of the agreement shall be reviewed and approved by the city attorney. 5. Proof of recording the agreement shall be provided to the city to issuance of building permits. a. The site shall be developed, used and maintained in conformance with the official exhibits, as updated through this amendment. 6. In addition to any other remedies, the developer or owner shall pay an administrative fee of $750 per violation of any condition of this approval. 7. Under the zoning ordinance, this permit shall be revoked and cancelled if the building or structure for which the permit is granted is removed. The city clerk is instructed to record certified copies of this resolution in the office of the Hennepin County Register of Deeds or Registrar of Titles as the case may be. Reviewed for administration: Adopted by the city council _________, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Approved as to form and execution: Melissa Kennedy, city clerk Soren Mattick, city attorney City council meeting of February 3, 2025 (Item No. 7a) Page 18 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Exhibit I Legal Descriptions The property at 5401 Gamble Drive is legally described as follows: Tracts D, E, F, and G, Registered Land Survey No. 1481, Hennepin County, Minnesota Torrens Property The property at 5402 Parkdale Drive is legally described as follows: Tract H, Registered Land Survey No. 1481, Hennepin County, Minnesota Torrens Property The property at 5353 Gamble Drive is legally described as follows: Tract C, Registered Land Survey No. 1481, Hennepin County, Minnesota Torrens Property The property at 5354 Parkdale Drive is legally described as follows: Tract I, Registered Land Survey No. 1481, Hennepin County, Minnesota Torrens Property City council meeting of February 3, 2025 (Item No. 7a) Page 19 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Exhibit II Special Permit Updated Site Plan 2025 City council meeting of February 3, 2025 (Item No. 7a) Page 20 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Resolution No. 25-__ Approving a conditional use permit for the property at 5353 Gamble Drive to have shared parking facilities on 1660 Highway 100 South Whereas, Hempel Real Estate, on behalf of BOF II MN West End Office Park LLC, owner of the subject property, legally defined in Exhibit A attached hereto, applied for approval of a conditional use permit under Section 36-33 of the St. Louis Park Ordinance Code to allow for the property at 5353 Gamble Drive to have shared parking facilities on 1660 Highway 100 South; and Whereas, the property is guided OFC – Office in the 2040 Comprehensive Plan future land use map; and Whereas, the property is located in the O – Office district and the Travel Demand Management overlay district; and Whereas, shared off-street parking facilities between properties is permitted via conditional use permit in the city code; and Whereas, the city council considered the planning commission recommendation and the information related to Planning Cases No. 24-28-PUD, 24-29-SP, and 24-30-CUP and the effect of the proposed shared parking on the health, safety, and welfare of the occupants of the surrounding lands, existing and anticipated traffic conditions, the effect on the value of properties in the surrounding area and the effect of the use on the Comprehensive Plan, and compliance with the intent of the zoning ordinance; and Whereas, the shared parking facilities will not have undue adverse impacts on the use and enjoyment of properties, existing and anticipated traffic conditions, parking facilities on adjacent streets, and values of properties in close proximity to the conditional use; and Whereas, the shared parking facilities will not have undue adverse impacts of governmental facilities, services or improvements that are existing or proposed, and the use is consistent with city utility plans; and Whereas, the site is consistent with the design and other requirements of the site and landscape plans, which have been prepared by the direction of a professional landscape architect or civil engineer registered in the state and adopted as part of the conditions imposed on the use by the city council; and Whereas, the contents of Cases Nos. 24-28-PUD, 24-29-SP, and 24-30-CUP are hereby entered into and made part of the public hearing record and record of decisions for this case. City council meeting of February 3, 2025 (Item No. 7a) Page 21 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Now therefore be it resolved that the application for a conditional use permit for the property at 5353 Gamble Drive to have shared parking facilities for fifteen (15) parking spaces on 1660 Highway 100 South is approved with the following conditions: 1. The conditional use permit shall be conditional upon the approval of the special permit amendment as approved by Resolution No. 25-XX 2. The conditional use permit shall be conditional upon the approval of the rezoning of 5401 Gamble Drive to PUD, as approved by Ordinance No. XX-25 3. The uses shall have their highest peak demand for parking at substantially different times of the day or week, or an adequate amount of parking shall be available for both uses during shared hours of peak demand. 4. The minimum spaces required under a shared parking agreement shall be based on the number of spaces required for the use that requires the most parking. 5. A shared parking agreement shall be filed with the City. The terms of the shared parking agreement shall include, at a minimum: a. The hours, size and a description of the operation of each of the tenants. b. A dimensioned site plan showing the location and number of parking spaces. c. A plan for remediating conflicts between tenants. The plan shall identify the property owner or designee as being responsible for administering and enforcing the agreement. d. A statement acknowledging that the City may deny a proposed use or expansion of an existing use if it deems the site does not have sufficient parking. e. The plan shall be signed by the property owners. 6. A permanent easement for the shared parking spaces shall be established and a copy of the recorded easement shall be filed with the city prior to the city issuing any permits for work on the site. 7. The site shall be developed, used and maintained in conformance with the official exhibits. The city clerk is instructed to record certified copies of this resolution in the office of the Hennepin County Register of Deeds or Registrar of Titles as the case may be. Reviewed for administration: Adopted by the city council __________, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Approved as to form and execution: Melissa Kennedy, city clerk Soren Mattick, city attorney City council meeting of February 3, 2025 (Item No. 7a) Page 22 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Exhibit A Legal Description The property at 5353 Gamble Drive is legally described as follows: Tract C, Registered Land Survey No. 1481, Hennepin County, Minnesota Torrens Property City council meeting of February 3, 2025 (Item No. 7a) Page 23 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Ordinance No. __-25 Amending the St. Louis Park City Code relating to zoning by creating Section 36- 268-PUD 25 as a Planned Unit Development Zoning District for the property located at 5401 Gamble Dr. The City of St. Louis Park does ordain: Section 1. The city council has considered the advice and recommendation of the planning commission (Case No. 24-28-PUD, 24-29-SP, and 24-30-CUP) for amending the Zoning Ordinance Section 36-268-PUD 25. Section 2. The Zoning Map shall be amended by reclassifying the lands legally described as Tracts D, E, F, and G, Registered Land Survey No. 1481, Hennepin County, Minnesota from O- office to PUD 25. Section 3. The St. Louis Park Ordinance Code Section 36-268 is hereby amended to add the following Planned Unit Development Zoning District: Section 36-268-PUD 25. (a) Development Plans. The site located on property legally described as Tracts D, E, F, and G, Registered Land Survey No. 1481, Hennepin County, Minnesota, shall be developed, used and maintained in conformance with the following Final PUD approved Official Exhibits: V100 ALTA Survey V101 ALTA Survey A00 Cover Sheet A01 Project Information A02 Site Plan – Architectural A03 Site Plan – Lighting A04 Floor Plan – Level -1 A05 Floor Plan – Level 1 A06 Floor Plan – Level 2 A07 Floor Plan – Level 3-4 A08 Floor Plan – Level 5 A09 Floor Plan – Level 6 A10 Roof Plan A11 Exterior Elevations A12 Exterior Elevations A13 Exterior Elevations A14 Axonometrics A15 Perspectives A16 Perspectives A17 Renderings City council meeting of February 3, 2025 (Item No. 7a) Page 24 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 A17.1 Renderings A17.2 Renderings A18 Transparency Exhibit A19 Signage Exhibit A20 Shadow Study A21 Shadow Study A22 Greenspace Exhibit A23 Transit Shelter Exhibit A24 Overall Area Survey A25 General Development Plan C000 Cover Sheet C100 General Notes C200 Site Demolition Plan C201 Tree Inventory & Preservation Plan C300 Erosion and Sediment Control Plan – Phase 1 C301 Erosion and Sediment Control Plan – Phase 2 C302 Erosion and Sediment Control Details C303 SWPPP C400 Site Dimension Plan C401 Bus Stop Plan C402 Easement Plan C403 Semi Truck Turning Movement C500 Grading Plan C501 Storm Sewer Plan C600 Utility Plan C700 Construction Details C701 Construction Details C702 Construction Details C703 Construction Details C704 Construction Details C705 Construction Details C706 Construction Details C707 Construction Details L100 Landscape Plan L101 Landscape Enlargement L102 Landscape Enlargement L103 Landscape Enlargement L104 Landscape Enlargement L105 Amenity Terrace Enlargements L106 Amenity Terrace Enlargements L107 Amenity Terrace Enlargements L108 Temporary Green Space L200 Landscape Details L300 DORA Plan The Site shall also conform to the following requirements: City council meeting of February 3, 2025 (Item No. 7a) Page 25 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 1. The property shall be developed with a mixed-use building with 223 residential units and 21,000 square feet of commercial uses 2. The maximum height shall not exceed 81 feet and six (6) stories 3. The site shall include a minimum twelve (12) percent designed outdoor recreation area. 4. Parking shall be provided off-street in structured parking and surface parking lots i. A total of 231 parking spaces will be provided in structured parking. ii. A total of 133 parking spaces will be provided in surface parking lots iii. 31 spaces shall include Level 2 electric vehicle charging stations, two (2) of which provide parking access in compliance with the ADA. (b) Uses. (1) Permitted uses: The following uses are permitted in PUD 25: a. Multiple-unit residential dwellings. Uses associated with multiple-unit residential dwellings, including but not limited to, the residential office, fitness facility, mail room, assembly room or general amenity space. (2) Uses permitted with conditions: the following uses are permitted in PUD 25 if it complies with the conditions specified for the use in this subsection: a. Commercial uses: Commercial uses limited to the following: bank, coffee shop, food service, grocery store, large item retail, liquor store, medical or dental office, office, private entertainment (indoor), restaurants, retail, service, showroom, and studio. These commercial uses shall meet the following conditions: 1. Commercial uses are limited to the first floor. 2. Hours of operation, including loading/unloading of deliveries, for commercial uses shall be limited to 6 a.m. to 12 a.m. 3. In-vehicle sales or service shall have the following additional conditions: i. Drive-through facilities and stacking areas shall not be located within 100 feet of any parcel that is zoned residential and used or subdivided for residential use, or has an occupied institutional building, including but not limited to schools, religious institutions, and community centers, unless the entire facility and stacking areas are separated from the lot in an N district by a building wall. b. Stacking shall be provided for six cars per customer service point and shall comply with all yard requirements. c. This use shall only be permitted when it can be demonstrated that the operation will not have a significant adverse affect on the existing level of service on adjacent streets and intersections. d. The drive-through facility shall be designed so it does not impede traffic or impair vehicular and pedestrian traffic movement, or exacerbate the potential for pedestrian or vehicular conflicts. e. Access shall be to a roadway identified in the comprehensive plan as a collector or arterial or shall be City council meeting of February 3, 2025 (Item No. 7a) Page 26 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 otherwise located so that access can be provided without generating significant traffic on local residential streets. f. Any canopy constructed as part of this use shall be compatible with the architectural design and materials of the principal structure. g. The use is in conformance with the comprehensive plan including any provisions of the redevelopment chapter and the plan by neighborhood policies for the neighborhood in which it is located and conditions of approval may be added as a means of satisfying this requirement. 4. Outdoor storage is prohibited. (3) Accessory uses. The following uses are permitted in PUD 24 if the use complies with the conditions specified for the use in this subsection: a. Home occupations as regulated by this chapter. b. Gardens. c. Parking lots. d. Parking ramps. e. Incidental repair or processing which is necessary to conduct a permitted use and not to exceed ten percent of the gross floor area of the associated permitted use. f. Public transit stops/shelters. g. Catering, if accessory to food service, delicatessen, or retail bakery. h. Food service. i. Outdoor seating and service of food and beverages with the following conditions: 1. No speakers or other electronic devices which emit sound are permitted 2. Hours of operation shall be limited to 7:00 a.m. to 10:00 p.m. j. Accessory utility structures including: 1. Small wind energy conversion system as defined in 36-4 Definitions. 2. Solar energy systems. 3. Cisterns and rainwater collection systems. k. Outdoor storage is prohibited. (c) Special Performance Standards (1) All general zoning requirements not specifically addressed in this ordinance shall be met, including but not limited to: outdoor lighting, transparency, architectural design, landscaping, parking, and screening requirements. (2) Each commercial tenant space on the ground floor facing Gamble Drive and the corner of Gamble Drive and Park Place Boulevard shall have a direct and primary access to and from the street building façade and the access shall remain open during business hours. (3) All trash, garbage, waste materials, trash containers, and recycling containers shall be kept in the manner required by this Code. All trash handling and loading areas shall be screened from view within a waste enclosure. (4) Signs shall be allowed in conformance with the MX zoning districts with the following conditions: City council meeting of February 3, 2025 (Item No. 7a) Page 27 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 a. Freestanding monument signs shall utilize the same exterior materials as the principal buildings and shall not interfere with pedestrian, bicycle or automobile circulation and visibility, and shall be a maximum height of 15 feet; pole-mounted signs shall be prohibited. b. Wall signs of non-residential uses shall only be placed on the ground floor and exterior walls of the occupied tenant lease space, and/or a monument sign. c. Wall signs shall not be included in calculating the aggregate sign area on the lot if they meet the following outlined conditions: 1. Non-residential wall signs permitted by this section that do not exceed seven percent (7%) of the exterior wall area of the ground floor tenant lease space. 2. The sign is located on the exterior wall of the ground floor tenant lease space from which the seven percent sign area was derived. 3. No individual wall sign shall exceed 100 square feet in area. (5) Awnings. a. Awnings shall be constructed of heavy canvas fabric, metal and/or glass. Plastic and vinyl awnings are prohibited. b. Backlit awnings shall be prohibited. Section X. This ordinance shall take effect no sooner than 15 days after publication. Reviewed for administration: Adopted by the city council ___________, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Approved as to form and execution: Melissa Kennedy, city clerk Soren Mattick, city attorney First reading February 3, 2025 Second reading February 18, 2025 Date of publication February 27, 2025 Date ordinance takes effect March 14, 2025 City council meeting of February 3, 2025 (Item No. 7a) Page 28 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 DRAFT MINUTES January 15, 2025 Planning commission Members present: Jim Beneke, Mia Divecha, Matt Eckholm, John Flanagan, Estella Hughes (youth member), Sylvie Hyman, Jan Youngquist, Tom Weber Members absent: none Staff present: Laura Chamberlain, Sean Walther Guests: Bill Katter and Rick McKelvey, Hempel Real Estate; Evan Jacobsen, Tushie Montgomery Architects 1. Call to order – roll call. 2. Approval of minutes – none. 3. Hearings. 3a. Public Hearing: Terasa PUD; West End Office Park CUP and special permit amendment Applicant: Hempel Real Estate Case No: 24-28-PUD: 24-29-SP, 24-30-CUP Ms. Chamberlain presented the report. Commissioner Beneke asked about the vouchers and also distribution of 1-, 2- and 3-bedroom units and what is required by the city and what will be provided. Ms. Chamberlain stated the development includes 20% of the units at 50% AMI, and also requesting the city housing authority board allocates project-based vouchers for provide 30% AMI units. She stated that will cap how much is spent on rent at 30% of household income. Mr. Walther added the project-based units are federally subsidized for the difference between rents charged and the affordability at 30% of AMI. Ms. Chamberlain stated the developer subsidizes at the 50% AMI level and the gap between the 50% and 30% is covered by the voucher program. She added there is no specific requirements for each unit type with bedrooms. She stated when in preliminary talks with developers, which is discussed, and three- bedroom units are a priority of the city council so that is why they are included here. Mr. Walther added the housing authority required that the unit mix of affordable units to match the unit mix of market rate units in the building. He added this is all negotiated through the contract between the applicant and the economic development authority. Commissioner Hyman asked for clarification about staff’s proposed amendments to the conditions from what was presented in the report after “furthermore” and if it was everything up to the end on page 7. Ms. Chamberlain stated items 1-4 should be omitted and items 5 & 6 should be renumbered to become 1 & 2. City council meeting of February 3, 2025 (Item No. 7a) Page 29 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Commissioner Eckholm asked about negotiations with biking and transit and asked if reduced transit passes from Metro, for those living in the building is being discussed. Ms. Chamberlain stated yes and it is contemplated in the travel demand management plan draft which shows this is included for users of the site, and they are also exploring having real time transit information in the building as well. Commissioner Weber asked if the other two lots are owned by Hempel and if there are 3 owners in total. Ms. Chamberlain stated currently there is one owner for the 4 lots, Bridge. She added Hempel has a purchase agreement for the 2 west properties and Bridge will continue to own the two east properties. Bridge also owns a third office property to the east. Commissioner Weber asked about the special permit and if the other two lots get redeveloped, will this go away. Ms. Chamberlain stated yes if the two easterly properties redevelop in some manner, then at that time likely the special permit would be revoked. Commissioner Weber noted the EAW slide and asked if this is a city assessment of what could be developed. Ms. Chamberlain stated this was a maximum build scenario based on the current zoning and land use guidance to test possibilities and the infrastructure supporting the area. Commissioner Weber stated this is a dynamic and unique parcel that is right for a chance to go big. Mr. Walther stated the advantage of including the office tower in a future scenario was because office tends to have highest and most concentrated evening peak, so it helps test the impacts to traffic capacity in the peak hours and how well the existing infrastructure can handle this in the future. Commissioner Weber asked how many vouchers are in the city. Mr. Walther stated he does not know that number but can find out. He added in the last 5 years the number of vouchers have been added substantially after having been stagnant for many years and added the city is pleased to be able to serve more households. Commissioner Youngquist stated it is great to see the potentials for deeply affordable units at 30% AMI and asked if this will be St. Louis Park HRA vs. Metro HRA that handles the vouchers. Mr. Walther stated yes, St. Louis Park HRA would administer these. Commissioner Youngquist asked if the vouchers have been committed yet. Mr. Walther responded that they are not committed yet. Commissioner Youngquist asked about the tree replacement fund. Ms. Chamberlain stated this fund is dedicated and used to plant trees on public land. Mr. Walther added best efforts are made to plant trees replaced in the vicinity of the project and within 1 year of when the project opens. Chair Divecha asked why the special permit allowing office in an industrial area is being maintained when it is now zoned as office. Ms. Chamberlain stated in discussions with the applicant and current owner, the current owner preferred to maintain the special permit for their properties. Mr. Walther added there was concern there might be some legal non- conformities that would result if that permit was removed. City council meeting of February 3, 2025 (Item No. 7a) Page 30 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Chair Divecha asked if the green space will be used as a public space. Ms. Chamberlain stated the intention of that space is to be generally open to the public but privately owned, managed and maintained, and can include restrictions on the hours of use and programing on the site, with details arranged through the development contract. Chair Divecha asked about parking and if there is a certain formula for the number of spaces required per square foot of building. Ms. Chamberlain stated the city’s parking requirements for office uses are based off the square footage of the office building and today they exceed the city minimums, but if 37 spaces are removed for the shared green space there it will result in the parcel being below the minimum requirement by 15 spaces so those need to be accommodated to avoid the site from becoming non-conforming to the city parking requirements. Chair Divecha asked with shared parking will they have signs to make that clear. Ms. Chamberlain stated those details will be established through the actual shared parking agreement with the property owners. Mr. Walther stated he believes despite the shortfall based on the code requirements that the actual demand will be less and the site will have enough parking on its own, but the formulas in the ordinance require either a variance or CUP for off-site parking. Chair Divecha asked how the drive-through and pedestrian access for all the retail work. Ms. Chamberlain explained that in detail using the map. Chair Divecha asked if there are zoning requirements for drive-throughs. Ms. Chamberlain stated yes and explained that in detail, noting it is allowed in the office use district with the CUP. Commissioner Flanagan asked about idling in the drive-through and how exhaust impacts to residences above it will be handled. Ms. Chamberlain stated there are requirements for queuing spaces, but no requirements related to idling. Commissioner Flanagan stated that seems the idling under outdoor terraces seems like a disconnect with negative effects of exhaust. Commissioner Flanagan asked about the pedestrian path from the north and asked if there is a crosswalk there and if there is a plan to have one there. Ms. Chamberlain stated that could be a recommendation. Commissioner Hyman asked who owns the right of way on Park Place, Gamble, and Parkdale streets. Mr. Walther stated those are all city streets, and added the stop lights/traffic signals along Park Place Blvd are controlled by MNDOT because they tie into Hwys. 394 and 100 signal systems. Chair Divecha opened the public hearing. Bill Katter and Rick McKelvey, Hempel Real Estate, and Evan Jacobsen, Tushie Montgomery Architects were available for questions. City council meeting of February 3, 2025 (Item No. 7a) Page 31 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Mr. McKelvey stated they will address crosswalks, and noted staff explained the green space adequately. He added the terraces are 50 feet above street level and stated their HVAC system will adhere to intake rules related to this to avoid issue with the drive-through. Chair Divecha asked if there are retailers planned already. Mr. McKelvey stated yes, they do. Chair Divecha asked about the design, and stated she does not love facades that are not planned for pedestrians, and pedestrian access and she asked why they chose to do pedestrian access this way. Mr. McKelvey stated on a high-density mixed-use development it is more difficult, but stated this is a pedestrian-friendly design coming in from Gamble St. and from the south. He stated the drive-through is important for sales and economics related to the development. He stated some of those involved in reviewing the plan liked the drive-through option, especially those with mobility challenges and with small children. Commissioner Flanagan asked about the service vehicle entry. Mr. McKelvey stated the entrance is right entry only for service vehicles and deliveries and retail spaces. He added gate arms will control the entry. Commissioner Youngquist asked about the drive-through and about safe pedestrian access from the bus stop. Mr. McKelvey stated entrances are connected by sidewalks at all times, and more direct access is available when there is not a delivery vehicle loading/unloading. Commissioner Youngquist asked if the affordable units will be mixed throughout the building or concentrated in one area. Mr. McKelvey stated ordinance requires them to be distributed throughout and consistent with the building unit mix. Commissioner Youngquist talked about a restaurant development in the area and concern about Unteidts seasonal market being displaced again. She asked if the developer has had conversations with them yet about their location. Mr. McKelvey stated they have not had conversations with them yet and had not been contacted by them but are open to this discussion. Commissioner Eckholm asked if the developer is seeking assurances that the commercial tenants will build and use both entrances. Mr. McKelvey stated no, and added there is one primary entrance for the retail suites on the south. He stated on the grocery tenant on the north the entrance is still under negotiation and added a primary and secondary entrance would be nice. Commissioner Weber asked if there is a grocer tenant in mind and if that is conditional on the whole development's success. Mr. McKelvey stated they do have one in mind but cannot say who that is. He noted they are not concerned if the grocer tenant does not commit to the development and are confident in its marketability either way. Commissioner Eckholm asked about the service drive pavement and if it is more like the sidewalk vs. the driving areas. Mr. McKelvey stated yes it will. City council meeting of February 3, 2025 (Item No. 7a) Page 32 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Chair Divecha asked about the general economics to make this work with the drive-through and the units. Mr. McKelvey stated this was discussed with staff and their consultants and with the city council, the economic impact without the drive-through is more than $2 million, which would be significant. Chair Divecha asked if that would have impacted the affordability. Mr. McKelvey stated they would have had to increase the TIF request, and they wanted to minimize the term. Commissioner Hyman asked about the swing arm and how much space will be there for pedestrians. Mr. McKelvey stated when the interior swing arm is down, pedestrians will not be allowed to enter the space, when there is a service vehicle loading or unloading. Otherwise, the interior gate will be open 90% of the time. Mr. Jacobsen added there is a second traffic arm on the west side of the sidewalk that will prevent passenger vehicles from driving through at all times and limit access from the road to delivery trucks. Commissioner Hyman stated she is frustrated when pedestrian are waiting or getting on and off the bus and congregate and block the sidewalks, and she had concerns that the bus stop is against a building wall instead of next to an entrance to the complex. She stated she understands the rationale of the drive-through but is also concerned about space in that area for pedestrians at the bus stop. She asked if there will be adequate space for pedestrians waiting. Mr. McKelvey showed the slide and explained the location of the bus stop. Commissioner Hyman asked if it were not for the St. Louis Park parking requirements, how much parking would the developer want to have. Mr. McKelvey stated this design is correct and there is one stall per bedroom, so that is the target and the city’s parking requirement is appropriate. Chair Divecha closed the public hearing. Commissioner Eckholm stated he understands the concerns about the drive-through. He noted this is a big site and the developer is restoring a street grid to a site that has been curb cuts for over 50 years. He stated it is clear that they added uniqueness to the design, and he is appreciative of that. He stated he appreciates they are not just putting up a box. He stated while he prefers no drive-through here, he recognized the reality of it and to make it approachable and offer affordable housing for all. Chair Divecha added she wants a walkable city, but she does appreciate the context of the tradeoffs and that this has a high target of affordable housing, and meets the city’s strategic priorities, and if the drive-through is a compromise, she supports this. She stated she supports mixed-use and hopes the city goes to this increasingly. Commissioner Youngquist stated there is lots to love with the development, she likes the articulation and the affordability of the project. She likes the green space also, but she is not a fan of the drive-through, however added she will not hold up a multi-million-dollar project because of that. City council meeting of February 3, 2025 (Item No. 7a) Page 33 Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Commissioner Weber agreed and stated he is indifferent about the drive-through. He stated there is nothing walkable about the space now, and noted even through the stores face the parking and backspace, once inside you feel you are inside a community. He stated with Park Place Blvd. and opposite a massive development like Costco, it is nice the developer has created a walkable space with shops in this area, and he will support this. Commissioner Hyman stated she is excited about this project and the housing. She asked about the bike parking and how much is open to the public for use, and is a car parking spot needed in order to have a bike parking spot. She added she wants bikes, pedestrians and bus users thought of and hopes also the city will make this more accommodating for pedestrians as well. She added she is like to see the green space moved closer to the housing part, but stated it makes sense where it is centrally located. She added she does not like the drive-through. It was moved by Commissioner Beneke, seconded by Commissioner Weber, to recommend approval of the West End Office Park CUP, Terasa PUD, and the special permit amendment subject to the conditions recommended by staff. The motion passed unanimously. 4. Other Business – none. 5. Communications. Mr. Walther noted the next meeting is Feb. 5, 2025, and will include a public hearing on city property owned on Minnetonka Blvd. west of Lake Street. He stated there will also be a study session following that meeting as well. 6. Adjournment – 7:30 p.m. ______________________________________ ______________________________________ Sean Walther, liaison Mia Divecha, chair member CE D A R LAK E R D PARK PLACE BLVDGAMBLE DR PARK PLACE BLVDPARKDALE D R PARKDALE DRRIDGEDR UTICA AVE SDUKE DRWEST ENDBLVDP RIV A TE R D PARKDALE D RPARK PLACE BLVDGAMBLE DRP ARK PLACE BLVDRIDGEDRC E D A R L A KERD UTICA AVE SDUKE DRWESTENDBLVDSB H W Y 1 0 0 S TO P A R K D D R P RIV A T ERD POS Park and Open Space R-1 Single-Family Residence R-2 Single-Family Residence R-3 Two-Family Residence R-4 Multiple-Family Residence R- C High-Density Multiple Family MX-1 Vertical Mixed-Use MX-2 Neighborhood Mixed-Use C-1 Neighborhood Commercial C-2 General Commercial BP Business Park O Office I-P Industrial Park I-G General Industrial PUD Planned Unit Development Existing Zoning O Office Proposed Zoning PUD Planned Unit Development ¯ City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 34 ATM TUSHIE MONTGOMERY terasă | 01.09.2025 COVER SHEET | A00 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A terasă SHEET INDEX A0 | COVER SHEET CIVIL C000 | COVER SHEET C100 | GENERAL NOTES V100 | ALTA SURVEY V101 | ALTA SURVEY C200 | SITE DEMOLITION PLAN C201 | TREE INVENTORY & PRESERVATION PLAN C300 | EROSION & SEDIMENT CONTROL- PHASE 1 C301 | EROSION & SEDIMENT CONTROL- PHASE 2 C302 | EROSION & SEDIMENT CONTROL DETAILS C303 | SWPPP C400 | SITE DIMENSION PLAN C401 | BUS STOP PLAN C402 | EASEMENT PLAN C403 | TURNING MOVEMENT ANALYSIS C500 | GRADING PLAN C501 | STORM SEWER PLAN C600 | UTILITY PLAN C700 | CONSTRUCTION DETAILS C701 | CONSTRUCTION DETAILS C702 | CONSTRUCTION DETAILS C703 | CONSTRUCTION DETAILS C704 | CONSTRUCTION DETAILS C705 | CONSTRUCTION DETAILS C706 | CONSTRUCTION DETAILS C707 | CONSTRUCTION DETAILS L100 | LANDSCAPE PLAN L101 | LANDSCAPE ENLARGEMENT L102 | LANDSCAPE ENLARGEMENT L103 | LANDSCAPE ENLARGEMENT L104 | LANDSCAPE ENLARGEMENT L105 | AMENITY TERRACE ENLARGEMENTS L106 | AMENITY TERRACE ENLARGEMENTS L107 | AMENITY TERRACE ENLARGEMENTS L108 | TEMPORARY GREEN SPACE L200 | LANDSCAPE DETAILS L300 | DORA PLAN ARCHITECTURAL A01 | PROJECT INFORMATION A02 | SITE PLAN- ARCHITECTURAL A03 | SITE PLAN- LIGHTING A04 | FLOOR PLAN- LEVEL -1 A05 | FLOOR PLAN- LEVEL 1 A06 | FLOOR PLAN- LEVEL 2 A07 | FLOOR PLAN- LEVEL 3-4 A08 | FLOOR PLAN- LEVEL 5 A09 | FLOOR PLAN- LEVEL 6 A10 | ROOF PLAN A11 | EXTERIOR ELEVATIONS A12 | EXTERIOR ELEVATIONS A13 | EXTERIOR ELEVATIONS A14 | AXONOMETRICS A15 | PERSPECTIVES A16 | PERSPECTIVES A17 | RENDERINGS A17.1 | RENDERINGS A17.2 | RENDERINGS A18 | TRANSPARENCY EXHIBIT A19 | SIGNAGE EXHIBIT A20 | SHADOW STUDY A21 | SHADOW STUDY A22 | GREENSPACE EXHIBIT A23 | TRANSIT SHELTER EXHIBIT A24 | OVERALL AREA SITE PLAN A25 | OVERALL AREA SURVEY DRAWING ISSUANCE PUD APPLICATION PUD APPLICATION RESUBMITTAL PUD APPLICATION RESUBMITTAL ...................................................................11.20.2024 .............................................12.16.2024 .............................................01.09.2025 City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 35 ATM TUSHIE MONTGOMERY terasă | 01.09.2025 PROJECT INFORMATION | A01 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A PROJECT TEAM DEVELOPER HEMPEL REAL ESTATE 10050 CROSSTOWN CIRCLE, SUITE 600 EDEN PRAIRIE, MN 55344 RICK McKELVEY, SENIOR VP- DEVELOPMENT rmckelvey@hempelcompanies.com 612.919.5294 ARCHITECT TUSHIE MONTGOMERY ARCHITECTS 7645 LYNDALE AVENUE SOUTH, SUITE 100 MINNEAPOLIS, MN 55423 EVAN JACOBSEN, ARCHITECT evanj@tmiarchitects.com 612.861.9636 CIVIL STRUCTURAL GENERAL CONTRACTOR SITE LOCATION SITE AUTOMOBILE PARKING PARKING- GARAGE STANDARD ADA COMPACT TANDEM TOTAL GARAGE PARKING 5401 GAMBLE DRIVE ST. LOUIS PARK, MN 55416 155 STALLS 05 STALLS 45 STALLS 26 STALLS 231 STALLS GROSS BUILDING AREA 76,142 GSF 28,276 GSF 45,477 GSF 45,467 GSF 45,467 GSF 40,685 GSF 37,019 GSF 318,533 GSF GARAGE 1ST FLOOR 2ND FLOOR 3RD FLOOR 4TH FLOOR 5TH FLOOR 6TH FLOOR TOTAL GROSS BUILDING AREA UNIT MIX 0 STUDIO 1 BED 2 BED 3 BED TOTAL UNITS 33 % 32 % 32 % 03 % 100 % 74 71 71 07 223 KIMLEY-HORN 767 EUSTIS STREET, SUITE 100 SAINT PAUL, MN 55114 ELI SANKEY, P.E. eli.sankey@kimley-horn.com 612.426.2215 ERA STRUCTURAL ENGINEERING 2550 UNIVERSITY AVE W, STE 423S ST. PAUL , MN 55114 RYAN BONNIWELL, PE, SE rbonniwell@eraseng.com 651.414.6157 WEIS BUILDERS, INC. 7645 LYNDALE AVENUE SOUTH, SUITE 300 MINNEAPOLIS, MN 55423 CHRIS EHALT ChrisEhalt@weisbuilders.com 612.243.4650 AMENITY SPACE PER FLOOR 0 SF 5,876 SF 4,149 SF 0 SF 0 SF 761 SF 758 SF 11,544 SF GARAGE 1ST FLOOR 2ND FLOOR 3RD FLOOR 4TH FLOOR 5TH FLOOR 6TH FLOOR TOTAL AMENITY AREA UNITS PER FLOOR 2ND FLOOR 3RD FLOOR 4TH FLOOR 5TH FLOOR 6TH FLOOR 45 UNITS 48 UNITS 48 UNITS 43 UNITS 39 UNITS UNIT SIZE RANGES 0 STUDIO 1 BED 2 BED 3 BED 521 - 581 SF 706 - 822 SF 914 - 1135 SF 1478 - 1548 SF UNIT MATRIX PARKING- SURFACE STANDARD ADA COMPACT TOTAL SURFACE PARKING TOTAL PARKING PROVIDED AUTO PARKING REQ'D 126 STALLS 05 STALLS 02 STALLS 133 STALLS 364 STALLS 339 STALLS PROJECT INFO.PROJECT INFO. BICYCLE PARKING CODE INFORMATIONPROJECT NARRATIVE SITE AREA ACRES 3.31 ACRES(144,378 SF) ZONING CURRENT ZONING 2040 LAND USE PROPOSED ZONING O (OFFICE) O (OFFICE) PUD BICYCLE PARKING- INDOOR BICYCLE PARKING- EXTERIOR TOTAL BICYCLE PARKING BICYCLE PARKING REQ'D 187 STALLS 70 STALLS 257 STALLS 257 STALLS Terasa is a dynamic six-story, mixed-use redevelopment designed to revitalize the southern edge of the West End District in St. Louis Park. The project will feature 223 residential units situated above approximately 21,000 square feet of commercial and retail space. It will be complemented by around 135 surface parking stalls and 235 below-grade parking spaces to support both residents and visitors. Located at 5401 Gamble Drive on a 3.31-acre site, the property is currently zoned for office use, with an existing multi-story office building on the land. To accommodate the new development, the project will apply for City Approval through a Planned Unit Development (PUD) application, which will rezone the property from "Office" to "PUD." This zoning change will best suit the creation of a vibrant, mixed-use environment that seamlessly integrates commercial and residential spaces. The project is expected to seek City approvals and permits from Fall 2024 through Spring 2025, with construction slated to begin in Summer 2025. The development is projected to take 20-24 months to complete, with an anticipated opening in Spring 2027. Level 2 1 Bed A 8 767 SF ... 769 SF 1 Bed B 5 706 SF ... 725 SF 1 Bed C 1 821 SF 2 Bed A 5 1062 SF ... 1079 SF 2 Bed B 1 1058 SF 2 Bed C 1 1137 SF 2 Bed C - Type A 1 1136 SF 2 Bed D 1 1034 SF 2 Bed E 2 1065 SF 2 Bed F 1 943 SF 2 Bed G 1 1023 SF 2 Bed H 1 911 SF 2 Bed I 1 1136 SF 3 Bed B 1 1547 SF Studio A 12 528 SF ... 532 SF Studio B 2 581 SF ... 583 SF Studio C 1 512 SF Level 2: 45 Level 3 1 Bed A 9 762 SF ... 764 SF 1 Bed B 5 702 SF ... 715 SF 1 Bed C 1 816 SF 2 Bed A 5 1057 SF ... 1074 SF 2 Bed B 2 1054 SF ... 1063 SF 2 Bed C 1 1133 SF 2 Bed C - Type A 1 1122 SF 2 Bed D 1 1028 SF 2 Bed E 2 1063 SF ... 1063 SF 2 Bed F 1 943 SF 2 Bed G 1 1019 SF 2 Bed H 1 897 SF 2 Bed I 1 1119 SF 3 Bed A - Type A 1 1370 SF 3 Bed B 1 1546 SF Studio A 12 531 SF ... 532 SF Studio B 2 577 SF ... 579 SF Studio C 1 500 SF Level 3: 48 Level 4 1 Bed A 8 767 SF ... 769 SF 1 Bed A- Type A 1 768 SF 1 Bed B 5 706 SF ... 725 SF 1 Bed C 1 822 SF 2 Bed A 5 1062 SF ... 1079 SF 2 Bed B 2 1058 SF ... 1067 SF 2 Bed C 2 1136 SF ... 1137 SF 2 Bed D 1 1034 SF 2 Bed E 2 1065 SF ... 1065 SF 2 Bed F 1 942 SF 2 Bed G 1 1022 SF 2 Bed H 1 909 SF 2 Bed I 1 1136 SF 3 Bed A 1 1375 SF 3 Bed B 1 1546 SF Studio A 12 531 SF ... 532 SF Studio B 2 581 SF ... 583 SF Studio C 1 511 SF Level 4: 48 Level 5 1 Bed A 8 767 SF ... 768 SF 1 Bed B 5 706 SF ... 725 SF 1 Bed C - Type A 1 822 SF 2 Bed A 4 1062 SF ... 1079 SF 2 Bed B 1 1061 SF 2 Bed C 2 1136 SF ... 1137 SF 2 Bed E 2 1065 SF ... 1065 SF 2 Bed F 1 942 SF 2 Bed G 1 1022 SF 2 Bed H 1 909 SF 2 Bed I 1 1138 SF 3 Bed B 1 1548 SF Studio A 12 531 SF ... 532 SF Studio B 2 581 SF ... 583 SF Studio C 1 511 SF Level 5: 43 Level 6 1 Bed A 8 767 SF ... 768 SF 1 Bed B 4 706 SF ... 725 SF 1 Bed D 1 762 SF 2 Bed A 4 1060 SF ... 1063 SF 2 Bed C 2 1136 SF ... 1137 SF 2 Bed E 2 1065 SF ... 1065 SF 2 Bed F 1 942 SF 2 Bed G 1 1022 SF 2 Bed H 1 908 SF 3 Bed B 1 1505 SF Studio A 11 531 SF ... 532 SF Studio B 2 581 SF ... 583 SF Studio C 1 512 SF Level 6: 39 Grand total: 223 NAME COUNT AREA REQUIRED PARKING CALCULATION 266 RESIDENTIAL (74 Studio+71 One Bed+(71 Two Bed x1.5)+(7 Three Bed x2)) + 12 GUEST (223 Units x 0.05)+ 12 RETAIL A (2,250 SF/200)+ 34 RETAIL B (13,603 SF/400)+ 10 RETAIL C (2,706 SF/300) + 5 RETAIL D (1,242 SF/250)= 339 STALLS ELECTRIC VEHICLE CHARGING LEVEL II EVCS PROVIDED- GARAGE LEVEL II EVCS PROVIDED- SURFACE TOTAL LEVEL II EVCS PROVIDED LEVEL II EVCS REQUIRED FUTURE LEVEL II EVCS- GARAGE FUTURE LEVEL II EVCS- SURFACE TOTAL FUTURE LEVEL II EVCS ACCOM. FUTURE LEVEL II EVCS REQUIRED 23 STALLS 07 STALLS 30 STALLS 30 STALLS 116 STALLS 67 STALLS 183 STALLS 183 STALLS REQUIRED BIKE PARKING CALCULATION 250 RESIDENTIAL (223 Units+(266 Req. Parking x 0.1)) +7 RETAIL (61 Req. Parking x 0.1) PROJECT TEAM PROJECT INFO. DRAWINGS AND CONSTRUCTION SHALL COMPLY WITH MINNESOTA BUILDING CODE AS ADOPTED MARCH 31, 2020, INCLUDING INTERNATIONAL BUILDING CODE, YEAR 2018 EDITION AS ADOPTED, QUALIFIED AND AMENDED. GENERAL COMPLIANCE *MN CODE REQUIRES 2% OF TOTAL UNITS ARE TYPE A. **ROLL-IN SHOWER LOCATED IN ROOM #219 TYPE A UNITS 1 BED C, TYPE A 2 BED C, TYPE A 3 BED B, TYPE A 5 UNITS (2.2%) ROOMS #432, 532 ROOMS #219**, 319 ROOM #301 ACCESSIBLE UNITS 2020 MINNESOTA BUILDING CODE 2024 MINNESOTA COMMERCIAL ENERGY CODE 2020 MINNESOTA ACCESSIBILITY CODE 2020 MINNESOTA MECHANICAL AND FUEL GAS CODE 2020 MINNESOTA PLUMBING CODE 2020 MINNESOTA FIRE CODE 2020 MINNESOTA ELECTRICAL CODE 2020 MINNESOTA BUILDING CODE ADMINISTRATION 2020 MINNESOTA PROVISIONS OF STATE BUILDING CODE 2020 MINNESOTA ELEVATOR AND RELATED DEVICES CODE ANY CODE PROVISIONS NOT ADDRESSED WITHIN THESE ENTITLEMENT DRAWINGS ARE TO BE CLARIFIED IN THE BUILDING PERMIT APPLICATION SET. MISC. PROVISIONS • THE USE OF NATURAL GAS TO POWER THE EMERGENCY GENERATOR SHALL BE PERMITTED PER NEC 700.12(D)(2)(c). THE STIPULATIONS PROVIDED IN NFPA 110 SECTIONS 7.9.7-8 SHALL BE MET AS A QUALIFICATION TO THIS EXCEPTION. • AREAS WHERE TRAVEL OVER OR LOADING OF A STRUCTURE BY FIRE DEPARTMENT VEHICLES SHALL BE ANALYZED FOR THE INDICATED LOADING SCENARIOS, IN ACCORDANCE WITH AASHTO STANDARDS. STRUCTURAL MEMBERS SHALL BE DESIGNED FOR THE MOST SEVERE CASE. • PENETRATIONS OF DRYER DUCTS, BATH FANS, AND KITCHEN EXHAUSTS SHALL BE PERMITTED WHERE PROTECTED IN ACCORDANCE WITH THE FIRE AND SMOKE PROTECTION FEATURES OUTLINED IN CHAPTER 7 OF THE IBC. ABBREVIATED CODE ANALYSIS LOWER LEVEL GARAGE OCCUPANCY GROUP: CONSTRUCTION TYPE/FIRE RATING: MAX. STORIES: MAX. HEIGHT: S-2 I-A UNLIMITED STORIES UNLIMITED HEIGHT PODIUM- 1ST FLOOR RETAIL & COMMON AREAS OCCUPANCY GROUP: CONSTRUCTION TYPE/FIRE RATING: MAX. STORIES: MAX. HEIGHT: M / A-3 I-A UNLIMITED STORIES UNLIMITED HEIGHT BUILDING ABOVE PODIUM- LEVELS 2-6 OCCUPANCY GROUP: CONSTRUCTION TYPE/FIRE RATING: MAX. STORIES: MAX. HEIGHT: R-2 III-A 5-STORIES 85' ABOVE GRADE RETAIL AREA RETAIL A RETAIL B RETAIL C RETAIL D TOTAL RETAIL 2,405 GSF 14,265 GSF 2,850 GSF 1,309 GSF 20,829 GSF City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 36 5353 GAMBLE DR.5354 PARKDALE DR.GAMBLE DR.PARK PLACE BLVD.GREEN SPACE- SEE LANDSCAPE PLAN 6-STORY MIXED USE LEVEL 1: RETAIL & APARTMENT LOBBY LEVELS: 2-6 APARTMENT UNITS 6-STORY MIXED USE LEVEL 1: RETAIL & APARTMENT LOBBY LEVELS 2-6: APARTMENT UNITS 1- STORY APT1-STORY RETAILSURFACE PARKING 133 STALLS 1-STORY 4-STORY4-STORY 5-STORYPARK PLACE BLVD.GAMBLE DR. GARAGE ENTRY DROP OFF LANEAPT ENTRYEXTENSION OF WEST END BLVD.DRIVE THRU ENTRYTRAFFIC BARRIER ARMS PROPOSED LOCATION OF NEW TRANSIT SHELTER FREE STANDING SCREEN WALL CURRENT LOCATION OF TRANSIT SHELTER TRANSFORMER TRANSFORMER 5-STORY 1-STORY RETAIL GENERATOR DRIVE THRU BELOW SERVICE DRIVE BELOW VEHICLE DRIVE BELOW BIKE (10)BIKE (8)BIKE (12)BIKE (12)BIKE (8)BIKE (12)BIKE (8)GREEN SPACE- SEE LANDSCAPE PLAN ATM TUSHIE MONTGOMERY terasă | 01.09.2025 SITE PLAN-ARCHITECTURAL | A02 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE:1" = 160'-0" 2 KEY PLAN - SITE SCALE:1" = 60'-0" 1 SITE PLAN NOTES: -ANY SURFACE BIKE RACKS LOCATED WITH THE R.o.W/ROAD EASEMENT ARE TO CONFORM WITH THE REQUIREMENTS OF THE SPECIAL SERVICES DISTRICT. SPECIFIC BIKE RACK FIXTURE SUBJECT TO CHANGE PER DISTRICT REQUIREMENTS. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 37 APARTMENT PARKING 231 STALLS 27 32 UP02 Service/ Loading Above 23 04 23 03 10 06 18' - 0" 24' - 0" 18' - 0" 18' - 0" 24' - 0" 18' - 0" 18' - 0" 24' - 0" 18' - 0" 36' - 0"24' - 0" 18' - 0" 24' - 0" 18' - 0" 18' - 0" 24' - 0" 22 04 23 0423 02 26 09 08 06 23 04 23 03 10 07 WATER ELECTRICAL TRASH ELEV 2 STAIR 2 MECHANICAL STAIR 3 ELEV 3 MECH/ ELECELEV 1 STAIR 1 11' - 5 3/16"261' - 10 9/16"9' - 11 1/4" 33' - 7 7/8" 25' - 10 1/4" 148' - 5 21/32"10' - 11 1/4"124' - 11 5/8"36' - 3 31/32"307' - 4 9/16"68' - 0 5/16"13' - 5 1/4"14' - 2"142' - 2 5/16"153' - 7 3/4"10' - 1 3/4"124' - 8 9/16"FD FD FD 2.3% 2.3% 2.3% 1.8% 1.8% 1.8%18.0%9.2%21' - 11 1/4" 11' - 9" 32' - 0 1/4" 65' - 8 1/2"134' - 10 5/16"95' - 7 9/16" 320' - 8 1/2"342' - 9 1/8"BUILDING OUTLINE ABOVE (LEVEL 1) RT12 0112 01 12 02 12 02 12 03 RESIDENTIAL GN 19 UP UP UP 10 06 10 06 23 04 UP STAIR 4 BUILDING OUTLINE ABOVE (LEVEL 1) AUTOMOBILE PARKING SUMMARY STANDARD ADA COMPACT TANDEM TOTAL GARAGE PARKING 155 STALLS 05 STALLS 45 STALLS 26 STALLS 231 STALLS STANDARD ADA COMPACT TOTAL SURFACE PARKING 126 STALLS 05 STALLS 02 STALLS 133 STALLS *REQUIRED PARKING CALCULATION 266 RESIDENTIAL (74 Studio+71 One Bed+(71 Two Bed x1.5)+(7 Three Bed x2)) + 12 GUEST (223 Units x 0.05)+ 12 RETAIL A (2,250 SF/200)+ 34 RETAIL B (13,603 SF/400)+ 10 RETAIL C (2,706 SF/300)+ 5 RETAIL D (1,242 SF/250)= 339 STALLS PARKING TOTALS- GARAGE PARKING TOTALS- SURFACE 364 STALLS 339 STALLS TOTAL PARKING PROVIDED TOTAL PARKING REQUIRED* PARKING SIZE REQUIREMENTS STANDARD ADA 8'-0" X 16'-0" 24'-0" BICYCLE PARKING SUMMARY BICYCLE PARKING- INDOOR (DERO SOLO) BICYCLE PARKING- EXTERIOR (LANDSCAPE FORMS RING) 188 STALLS 70 STALLS BICYCLE PARKING TOTALS TOTAL BICYCLE PARKING PROVIDED TOTAL BICYCLE PARKING REQUIRED**257 STALLS 257 STALLS **REQUIRED BIKE PARKING CALCULATION 250 RESIDENTIAL (223 Units+(266 Req. Parking x 0.1)) + 7 RETAIL (61 Req. Parking x 0.1) = 257 STALLS **REQUIRED EVCS CALCULATION 27 RESIDENTIAL (266 Req. Parking x 0.1)+ 3 RETAIL (61 Req. Parking x 0.05) = 30 STALLS COMPACT AISLE 8'-6" X 18'-0" 8'-0" X 18'-0" LEVEL II EVCS PROVIDED LEVEL II EVCS REQUIRED** FUTURE LEVEL II EVCS ACCOMODATED 30 STALLS 30 STALLS 183 STALLS ATM TUSHIE MONTGOMERY terasă | 01.09.2025 FLOOR PLAN-LEVEL -1 | A04 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE: 1" = 40'-0" 1 PARKING LEVEL - 1 PLAN FLOOR PLAN KEYNOTES Key Value Keynote Text 08 06 OVERHEAD DOOR 10 06 DERO SOLO WALL MOUNTED BIKE HOOK 10 07 BOLLARD 12 01 6 CU. YD. DUMPSTER- TRASH 12 02 6 CU. YD. DUMPSTER- RECYCLE 12 03 4 CU. YD. DUMPSTER- COMPOST 22 04 FLOOR DRAIN 23 02 INTAKE LOUVER AT AREA WELL, SEE MECH. 23 03 EXAUST LOUVER AT AREA WELL, SEE MECH. 23 04 AREA WELL 26 09 SPACE FOR ADDITIONAL ELECTRICAL EQUIPMENT, SIZED TO ACCOMODATE FUTURE ELECTRICAL VEHICLE CHARGING STATIONS FOR UP TO 50% OF TOTAL PARKING STALLS GN 19 ALL PARKING FACILITIES TO COMPLY WITH THE SECURITY AND BROADBAND READINESS REQUIREMENTS. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 38 17 27 05 RETAIL PARKING - NORTH 99 STALLS REATIL PARKING- SOUTH34 STALLS11 PUBLIC PARKING 133 STALLS 13 123 4 5 6 7 8 9 10 12 GARAGE ENTRY RETAIL B 1 A11 11 11 28 12 North Parking South Parking 808 SF AMENITY 1 A12 2 A12 1 A13 2 A13 RETAIL C RETAIL A RETAIL D RESIDENTIALRETAIL B RETAIL A/D/C APARTMENT LOBBY 4,882 SF 09 08 07 23 04 ELEV 3 STAIR 308 06 10 03 10 03 GN 13 GN 17 10 01 RAMP DN 03 14 05 22 23 04 10 07 03 03 26 02 26 05 26 01 26 04 23 04 22 01 18' - 4"24' - 0"18' - 0"18' - 0"24' - 0"18' - 0"18' - 0"24' - 0"18' - 0"24' - 0" 18' - 0"4' - 10 7/16"144' - 9 15/16" 76' - 6 1/4" 24' - 0" 32' - 4 15/16" 54' - 4 11/16"97' - 2 9/16"43' - 0 5/8"166' - 9 3/8"ELEV 2 STAIR 2ELEV 1 STAIR 1 GN 14 22 01 22 01 DN26 01 2,405 SF 1,309 SF 2,850 SF 9' - 9 7/8" 20' - 11 3/4" 11' - 9" 29' - 10 1/4" 1' - 10"19' - 10 9/32" 30' - 3 23/32" 12' - 9 1/4" 14' - 2"336' - 9 1/2"74' - 2 7/8"77' - 1 1/4"307' - 0 9/16"16' - 2 5/8"79' - 5 5/8"16' - 0 11/32"172' - 7 15/16"35' - 11 31/32" 320' - 4 1/2"TRASH STAGINGR T TRASH TRASHTRASH 12 02 12 02 12 01 12 01 12 01 12 02 12 04 12 05 12 03 12 06 12 04 12 05 12 03 GN 19 GN 20 GN 20 UP UP DNUP 10 07 STAIR 4 13,731 SF 11' - 0" 5' - 6 1/8" 32 30 32 30 08 08 AUTOMOBILE PARKING SUMMARY STANDARD ADA COMPACT TANDEM TOTAL GARAGE PARKING 155 STALLS 05 STALLS 45 STALLS 26 STALLS 231 STALLS STANDARD ADA COMPACT TOTAL SURFACE PARKING 126 STALLS 05 STALLS 02 STALLS 133 STALLS *REQUIRED PARKING CALCULATION 266 RESIDENTIAL (74 Studio+71 One Bed+(71 Two Bed x1.5)+(7 Three Bed x2)) + 12 GUEST (223 Units x 0.05)+ 12 RETAIL A (2,250 SF/200)+ 34 RETAIL B (13,603 SF/400)+ 10 RETAIL C (2,706 SF/300)+ 5 RETAIL D (1,242 SF/250)= 339 STALLS PARKING TOTALS- GARAGE PARKING TOTALS- SURFACE 364 STALLS 339 STALLS TOTAL PARKING PROVIDED TOTAL PARKING REQUIRED* PARKING SIZE REQUIREMENTS STANDARD ADA 8'-0" X 16'-0" 24'-0" BICYCLE PARKING SUMMARY BICYCLE PARKING- INDOOR (DERO SOLO) BICYCLE PARKING- EXTERIOR (LANDSCAPE FORMS RING) 188 STALLS 70 STALLS BICYCLE PARKING TOTALS TOTAL BICYCLE PARKING PROVIDED TOTAL BICYCLE PARKING REQUIRED**257 STALLS 257 STALLS **REQUIRED BIKE PARKING CALCULATION 250 RESIDENTIAL (223 Units+(266 Req. Parking x 0.1)) + 7 RETAIL (61 Req. Parking x 0.1) = 257 STALLS **REQUIRED EVCS CALCULATION 27 RESIDENTIAL (266 Req. Parking x 0.1)+ 3 RETAIL (61 Req. Parking x 0.05) = 30 STALLS COMPACT AISLE 8'-6" X 18'-0" 8'-0" X 18'-0" LEVEL II EVCS PROVIDED LEVEL II EVCS REQUIRED** FUTURE LEVEL II EVCS ACCOMODATED 30 STALLS 30 STALLS 183 STALLS ATM TUSHIE MONTGOMERY terasă | 01.09.2025 FLOOR PLAN-LEVEL 1 | A05 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE: 1" = 40'-0" 1 LEVEL 1 PLAN FLOOR PLAN KEYNOTES Key Value Keynote Text 03 03 CONCRETE COLUMN AT OPEN-AIR PARKING- PAINTED WHITE TO 4'-0" A.F.F., TYP. 03 14 CONCRETE PATIO - BROOM FINISH 05 22 PERFORATED METAL PANEL ON POWDER COATED METAL FRAME 08 06 OVERHEAD DOOR 08 07 DRIVE THRU WINDOW 08 08 3'-0" X 7'-0" GATE, EXIT ONLY 10 01 RECESSED WALK OFF MAT PLACED 12" FROM WALL, RECESS 1" 10 03 BARRIER GATE ARM & CONTROL OPERATOR 10 07 BOLLARD 12 01 6 CU. YD. DUMPSTER- TRASH 12 02 6 CU. YD. DUMPSTER- RECYCLE 12 03 4 CU. YD. DUMPSTER- COMPOST 12 04 4 CU. YD. DUMPSTER- TRASH 12 05 4 CU. YD. DUMPSTER- RECYCLE 12 06 24 GAL. CONTAINER- COMPOST 22 01 FLOOR DRAIN 23 04 AREA WELL 26 01 TRANSFORMER 26 02 PROPOSED LOCATION FOR ADDITIONAL TRANSFORMER, SIZED TO SERVICE FUTURE ELECTRICAL VEHICLE CHARGING STATIONS FOR UP TO 50% OF TOTAL PARKING STALLS 26 04 PROVIDE CHARGING STATION FOR ELECTRIC CAR 26 05 GENERATOR 32 30 TIME RESTRICTED PARKING GN 13 SERVICE ENTRY/ PEDESTRIAN CORRIDOR GN 14 PROPOSED LOCATION OF NEW TRANSIT SHELTER GN 17 FREE STANDING SCREEN WALL GN 19 ALL PARKING FACILITIES TO COMPLY WITH THE SECURITY AND BROADBAND READINESS REQUIREMENTS. GN 20 COMMERCIAL AND DWELLING UNITS SHALL COMPLY WITH BROADBAND READINESS REQUIREMENTS. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 39 02 08 07 16 01TALLEST POINT OF WEST ELEV.80' - 2 3/8"18 2102161317 04 1011 03052019 14070108 20 10A19 2 A19 6 A19 1 A19 3 A19 4 A19 13 15 12 08 040614A19 19 Sim 2114 07 01 1512 02 17 1216 04 09 0102041005 TALLEST POINT OF NORTH ELEV.80' - 8 3/8"19 13 A19 2 Sim 05 11 02 14 10180806 A19 17 Sim A19 20 A19 21 Sim STUCCO #1 STUCCO OFF-WHITE VARIED REVEALS PRODUCT: COLOR: OTHER: METAL PANEL #1 NORWOOD METAL PANEL MAC ARCHITECTURAL TEAK PRODUCT: MANUFACT.: COLOR: METAL PANEL #2 HARRYWOOD METAL PANEL MAC ARCHITECTURAL BLACK WALNUT PRODUCT: MANUFACT.: COLOR: MASONRY #1 VENEER- FRENCH LIMESTONE CORONADO COUNTRY BEIGE PRODUCT: MANUFACT.: COLOR: ACCENT #1 - VERTICAL FIN METAL TUBING TBD PAINT TO MATCH M.P. #1 PRODUCT: MANUFACT.: COLOR: MATERIAL KEY ACCENT #2- METAL SCREEN METAL SCREEN- MEDALLION REVAMP PANELS BLACK PRODUCT: MANUFACT.: COLOR: METAL PANEL #3 ACM METAL PANEL ALUCOBOND DARK BRONZE PRODUCT: MANUFACT.: COLOR: 01 02 03 04 05 08 09 ADDITIONAL KEYNOTES 10 STOREFRONT- VISION GLASS 11 STOREFRONT- SPANDREL GLASS 12 COMPOSITE WINDOW 13 SLIDING PATIO DOOR 14 ALUMINUM & GLASS RAILING SYSTEM 15 ALUMINUM BALCONY WITH GLASS RAILING 16 PAINTED METAL LOUVER 17 PREFINISHED METAL COPING 18 ALUMINUM CANOPY 19 METAL AWNING 20 SIGNAGE- SEE SHEET A19 21 ELEVATOR OVERRUN FIBER CEMENT #1 FIBER CEMENT PANEL JAMES HARDIE BLACK PRODUCT: MANUFACT.: COLOR: 07 MASONRY #2 BURNISHED BLOCK TBD TBD PRODUCT: MANUFACT.: COLOR: 06 ATM TUSHIE MONTGOMERY terasă | 12.16.2024 EXTERIOR ELEVATIONS | A11 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE:1/32" = 1'-0" 1 WEST ELEVATION- PARK PLACE BLVD. SCALE: 1/32" = 1'-0" 2 NORTH ELEVATION- GAMBLE DR. WEST ELEVATION STUCCO (CLASS I) MASONRY (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) CLASS II TOTAL 6,785 SF (31%) 1,622 SF (08%) 6,532 SF (30%) 5,808 SF (27%) 800 SF (03%) 101 SF (01%) WEST ELEVATION TOTAL 21,648 SF (100%) 0'8'16'32' NORTH ELEVATION STUCCO (CLASS I) MASONRY (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) METAL PANEL SCREEN (CLASS II) CLASS II TOTAL 16,219 SF (70%) 6,810 SF (30%) NORTH ELEVATION TOTAL 23,029 SF (100%) 0'8'16'32' 14,939 SF (69%) 6,709 SF (31%) 8,354 SF (36%) 1,278 SF (05%) 6,587 SF (29%) 4,535 SF (20%) 772 SF (04%) 599 SF (02%) 904 SF (04%) City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 40 A19 15 A19 18 A19 510 04 02 12 210312151613 010218 07170107 20 11 B BA TALLEST POINT OF EAST ELEV.79' - 5 3/8"21 15 1312 101104 18 08 02 14 01 04 0208 10 07 1617 A19 16 14 17 0906 05 A19 21 STUCCO #1 STUCCO OFF-WHITE VARIED REVEALS PRODUCT: COLOR: OTHER: METAL PANEL #1 NORWOOD METAL PANEL MAC ARCHITECTURAL TEAK PRODUCT: MANUFACT.: COLOR: METAL PANEL #2 HARRYWOOD METAL PANEL MAC ARCHITECTURAL BLACK WALNUT PRODUCT: MANUFACT.: COLOR: MASONRY #1 VENEER- FRENCH LIMESTONE CORONADO COUNTRY BEIGE PRODUCT: MANUFACT.: COLOR: ACCENT #1 - VERTICAL FIN METAL TUBING TBD PAINT TO MATCH M.P. #1 PRODUCT: MANUFACT.: COLOR: MATERIAL KEY ACCENT #2- METAL SCREEN METAL SCREEN- MEDALLION REVAMP PANELS BLACK PRODUCT: MANUFACT.: COLOR: METAL PANEL #3 ACM METAL PANEL ALUCOBOND DARK BRONZE PRODUCT: MANUFACT.: COLOR: 01 02 03 04 05 08 09 ADDITIONAL KEYNOTES 10 STOREFRONT- VISION GLASS 11 STOREFRONT- SPANDREL GLASS 12 COMPOSITE WINDOW 13 SLIDING PATIO DOOR 14 ALUMINUM & GLASS RAILING SYSTEM 15 ALUMINUM BALCONY WITH GLASS RAILING 16 PAINTED METAL LOUVER 17 PREFINISHED METAL COPING 18 ALUMINUM CANOPY 19 METAL AWNING 20 SIGNAGE- SEE SHEET A19 21 ELEVATOR OVERRUN FIBER CEMENT #1 FIBER CEMENT PANEL JAMES HARDIE BLACK PRODUCT: MANUFACT.: COLOR: 07 MASONRY #2 BURNISHED BLOCK TBD TBD PRODUCT: MANUFACT.: COLOR: 06 ATM TUSHIE MONTGOMERY terasă | 01.09.2025 EXTERIOR ELEVATIONS | A12 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE:1/32" = 1'-0" 1 EAST ELEVATION SCALE: 1/32" = 1'-0" 2 SOUTH ELEVATION EAST ELEVATION STUCCO (CLASS I) MASONRY (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) METAL PANEL SCREEN (CLASS II) CLASS II TOTAL 13,215 SF (68%) 6,114 SF (32%) EAST ELEVATION TOTAL 19,329 SF (100%) 0'8'16'32' SOUTH ELEVATION- B (VISIBLE OFF SITE) STUCCO (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) CLASS II TOTAL 6,413 SF (60%) 4,281 SF (40%) SOUTH ELEVATION B TOTAL 10,694 SF (100%) 0'8'16'32' SOUTH ELEVATION- A (NOT VISIBLE OFF SITE) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) CLASS II TOTAL 3,480 SF (37%) 5,971 SF (63%) SOUTH ELEVATION A TOTAL 9,451 SF (100%) 7,365 SF (38%) 356 SF (02%) 5,494 SF (28%) 4,886 SF (25%) 600 SF (03%) 110 SF (01%) 518 SF (03%) 3,480 SF (37%) 4,915 SF (52%) 1,056 SF (11%) 3,363 SF (31%) 3,050 SF (29%) 3,379 SF (32%) 820 SF (07%) 82 SF (01%) City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 41 01 02 07 14 15 161312 10 1804 09 06 A19 7 A19 9 A19 10 A19 12 0112151316021407 10 0905 20 01010304 17 A19 2 Sim 06 A19 11 A19 6 Sim STUCCO #1 STUCCO OFF-WHITE VARIED REVEALS PRODUCT: COLOR: OTHER: METAL PANEL #1 NORWOOD METAL PANEL MAC ARCHITECTURAL TEAK PRODUCT: MANUFACT.: COLOR: METAL PANEL #2 HARRYWOOD METAL PANEL MAC ARCHITECTURAL BLACK WALNUT PRODUCT: MANUFACT.: COLOR: MASONRY #1 VENEER- FRENCH LIMESTONE CORONADO COUNTRY BEIGE PRODUCT: MANUFACT.: COLOR: ACCENT #1 - VERTICAL FIN METAL TUBING TBD PAINT TO MATCH M.P. #1 PRODUCT: MANUFACT.: COLOR: MATERIAL KEY ACCENT #2- METAL SCREEN METAL SCREEN- MEDALLION REVAMP PANELS BLACK PRODUCT: MANUFACT.: COLOR: METAL PANEL #3 ACM METAL PANEL ALUCOBOND DARK BRONZE PRODUCT: MANUFACT.: COLOR: 01 02 03 04 05 08 09 ADDITIONAL KEYNOTES 10 STOREFRONT- VISION GLASS 11 STOREFRONT- SPANDREL GLASS 12 COMPOSITE WINDOW 13 SLIDING PATIO DOOR 14 ALUMINUM & GLASS RAILING SYSTEM 15 ALUMINUM BALCONY WITH GLASS RAILING 16 PAINTED METAL LOUVER 17 PREFINISHED METAL COPING 18 ALUMINUM CANOPY 19 METAL AWNING 20 SIGNAGE- SEE SHEET A19 21 ELEVATOR OVERRUN FIBER CEMENT #1 FIBER CEMENT PANEL JAMES HARDIE BLACK PRODUCT: MANUFACT.: COLOR: 07 MASONRY #2 BURNISHED BLOCK TBD TBD PRODUCT: MANUFACT.: COLOR: 06 SCALE:1/32" = 1'-0" 1 WEST ELEVATION - INTERIOR COURTYARD SCALE: 1/32" = 1'-0" 2 EAST ELEVATION- INTERIOR COURTYARD ATM TUSHIE MONTGOMERY terasă | 12.16.2024 EXTERIOR ELEVATIONS | A13 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A 0'8'16'32' 0'8'16'32' EAST COURTYARD ELEVATION STUCCO (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) METAL PANEL SCREEN (CLASS II) CLASS II TOTAL 11,769 SF (82%) 2,510 SF (18%) EAST COURTYARD ELEVATION TOTAL 14,279 SF (100%) WEST COURTYARD ELEVATION STUCCO (CLASS I) MASONRY (CLASS I) GLAZING (CLASS I) CLASS I TOTAL METAL PANEL (CLASS II) FIBER CEMENT (CLASS II) BURNISHED BLOCK (CLASS II) CLASS II TOTAL 12,147 SF (76%) 3,752 SF (24%) WEST COURTYARD ELEVATION TOTAL 15,899 SF (100%) 5,735 SF (36%) 1,753 SF (11%) 4,659 SF (29%) 3,397 SF (21%) 234 SF (02%) 121 SF (01%) 8,107 SF (57%) 3,662 SF (25%) 1,913 SF (13%) 238 SF (02%) 141 SF (01%) 218 SF (02%) City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 42 ATM TUSHIE MONTGOMERY terasă | 12.16.2024 RENDERINGS | A17 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 43 ATM TUSHIE MONTGOMERY terasă | 12.16.2024 RENDERINGS | A17.1 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 44 ATM TUSHIE MONTGOMERY terasă | 12.16.2024 RENDERINGS | A17.2 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 45 5353 GAMBLE DR. GAMBLE DR. PROPOSED GREENSPACE 6-STORY MIXED USELEVEL 1: RETAIL & APARTMENT LOBBYLEVELS: 2-6 APARTMENT UNITSBENCHBENCHBIKEBENCH PAVERS- RELOCATE FROM PREVIOUS DEMO'D OUTDOOR AMENITY 2'x2' CONCRETE PAD W. 6" EMBEDDED SLEEVE FOR REMOVABLE LIGHTING POST EXTENT OF POTENTIAL POP-UP RINK- 52'x90' PROVIDE LOCKABLE OUTLET AT END POST PROVIDE LOCKABLE OUTLET AT END POSTBENCH POTENTIAL LIGHTING STREET LIGHTING TO MATCH NEW DEVELOPMENT ANCHORED BENCH SEATING CITY STANDARD SIDEWALK ATM TUSHIE MONTGOMERY terasă | 12.16.2024 GREENSPACE EXHIBIT | A22 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE:1/32" = 1'-0" 1 GREENSPACE- ENLARGED PLAN PRECEDENT IMAGERY THE GREENSPACE IS ENVISIONED AS A VERSATILE AREA THAT WILL CATER TO A VARIETY OF USES THROUGH ALL SEASONS OF THE YEAR. DURING WARMER MONTHS, THE OPEN GRASSY AREA COULD BE UTILIZED AS CASUAL SEATING FOR A FOOD TRUCK FESTIVAL, OR AN EXTENSION TO THE LOCAL STREET FAIR. IN THE WINTER A POP-UP ICE RINK WITH SEASONAL LIGHTING COULD ACTIVATE THE CORNER LEADING INTO THE WEST END. ASIDE FROM PROGRAMMED ACTIVITIES, THE GREENSPACE WOULD SERVE THE OCCUPANTS OF THE OFFICE PARK AND APARTMENT AS A PLACE TO EAT LUNCH OR TOSS A FRISBEE. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 46 Park Place Blvd.Screen Wall Drive-Thru Lane Clr. 6' - 0"Metal Panel #1 Clad Wall Accent Material Fin Element To Match Screen Wall Aluminum Bench, Attached to Screen Wall Tempered Glass PartitionClr.4' - 0" 4' - 10"Clr.4' - 0"5' - 0"8' - 0"Accessible Boarding Area Standard Bus Stop Signage Door Zone- 40' Bus Door Zone- 60' Bus 6'x 60' Clear Zone Bike Racks Bench Standard City Sidewalk Slope < 1.8% Accent Concrete w/ Integral Color Transformer & Connection Cabinet Planting Area- See Landscape90 Deg. Orientation15'X100"Stnd. Conn. Cab.2' - 6"2' - 6"2' - 6"10' - 0"BenchTraffic Barrier Arm Bollard Total Height11' - 0"Aluminum Bench, Dark Bronze Finish, Anchor to Screen Wall Tempered Glass Partition Aluminum Structure, Dark Bronze Finish, Anchor To Screen Wall Accent Vertical Fin Element, To Match Screen Wall Screen Wall Transformer & Connection Cabinet Bollard Behind Curb at Drive-Thru 6"EQEQ Aluminum Structure, Dark Bronze Finish, Anchor To Screen Wall Drive Thru Screen Wall Tempered Glass Partition Aluminum Structure, Dark Bronze Finish, Anchor to Screen Wall Drive Thru Screen Wall Aluminum Bench, Anchor to Screen Wall Accent Vertical Fin Element, To Match Screen Wall CMU Wall, Clad with Metal Panel #1 Vertical Accent Fins Extent of Transit Shelter (Beyond) Prefinished Metal Coping 55' - 2 1/2"8' - 0"ATM TUSHIE MONTGOMERY terasă | 12.16.1024 TRANSIT SHELTER EXHIBIT | A23 5401 Gamble Drive, St. Louis Park, MN 55416 | 224125A SCALE:3/32" = 1'-0" 1 Transit Shelter- Enlarged Plan SCALE:1/8" = 1'-0" 4 West Elevation- Transit Shelter SCALE: 1/8" = 1'-0" 3 South Elevation SCALE: 1/8" = 1'-0" 2 North Elevation SCALE: 1/8" = 1'-0" 5 West Elevation- Screen Wall City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 47 *03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?&&29(56+((7GZJ-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,6 9,&,1,7< 176 67/28,63$5.01 &2175$&7256+$//&21),507+$77+((;,67,1*&21',7,216)257+(6,7(0$7&+ :+$7,66+2:1217+('5$:,1*6,1&/8'('35,2572&216758&7,21 ,)5(352'8&('7+(6&$/(66+2:1217+(6(3/$16$5(%$6('21$[6+((7 $//1(&(66$5<,163(&7,216$1'25&(57,),&$7,2165(48,5('%<&2'(6$1'25 87,/,7<6(59,&(6&203$1,(66+$//%(3(5)250('35,2572$11281&('%8,/',1* 3266(66,21$1'7+(),1$/&211(&7,212)6(59,&(6 $//*(1(5$/&2175$&725:25.72%(&203/(7('($57+:25.),1$/87,/,7,(6 $1'),1$/*5$',1*%<7+(0,/(6721('$7(,1352-(&7'2&80(176 127(6 *(27(&+1,&$/(1*,1((5 %5$81,17(57(&&25325$7,21 +$036+,5($9(18(6 0,11($32/,601 7(/(3+21( &217$&75$<+8%(53( 352-(&77($0 (1*,1((5/$1'6&$3($5&+,7(&7 .,0/(<+251$1'$662&,$7(6,1& (1*,1((5(/,6$1.(<3( /$1'6&$3($&+,7(&767(3+(1+,00(5,&+3/$ (867,6675((768,7( 673$8/01 7(/(3+21( 2:1(5'(9(/23(5 +(03(/5($/(67$7( &526672:1&,568,7( ('(135$,5,(01 7(/(3+21( &217$&75,&.0&.(/9(< 7(5$6Ă *$0%/('5,9( )25 6,7('(9(/230(173/$16 $5&+,7(&7 786+,(0217*20(5<$5&+,7(&76 /<1'$/($9(18(6287+ 68,7(0,11($32/,601 7(/(3+21( &217$&7(9$1-$&2%6(1$,$ 6,7(%(1&+0$5.6 /2&$7,2166+2:1216859(< 6%07232)7231872)),5(+<'5$17217+(6287+6,'(2) *$0%/('5,67+<'5$17($672)3$5.3/$&( (/(9$7,21 6%07232)7231872)),5(+<'5$17)71257+:(672) 7+(1257+:(67%8,/',1*&251(5 (/(9$7,21 6%07232)7231872)),5(+<'5$17)76287+:(672) 7+(6287+:(67%8,/',1*&251(52) (/(9$7,21 %(1&+0$5.6 35(3$5(')25&29(56+((7&7(5$6Ă+(03(/5($/(67$7(67/28,63$5.016,7( *$0%/('5,9(3$5.3/$&(%28/(9$5'3$5.'$/( ' 5 , 9 ( & ( ' $ 5 / $ . ( 5 2 $ ' 6 2 8 7 + ,016859(<25 681'(/$1'6859(<,1*//& ($67%/220,1*721)5((:$< 68,7(%/220,1*72101 7(/(3+21( &217$&7$5/((-&$5/6213/6 6KHHW/LVW7DEOH 6KHHW1XPEHU 6KHHW7LWOH &&29(56+((7 &*(1(5$/127(6 9$/7$6859(< 9$/7$6859(< &6,7('(02/,7,213/$1 &75((,19(1725< 35(6(59$7,213/$1 & (526,21$1'6(',0(17&21752/3/$13+$6( & (526,21$1'6(',0(17&21752/3/$13+$6( & (526,21$1'6(',0(17&21752/'(7$,/6 &6:333 &6,7(',0(16,213/$1 &%8667233/$1 &($6(0(173/$1 &7851,1*029(0(17$1$/<6,6 &*5$',1*3/$1 &672506(:(53/$1 &87,/,7<3/$1 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 &&216758&7,21'(7$,/6 //$1'6&$3(3/$1 //$1'6&$3((1/$5*(0(17 //$1'6&$3((1/$5*(0(17 //$1'6&$3((1/$5*(0(17 //$1'6&$3((1/$5*(0(17 /$0(1,7<7(55$&((1/$5*(0(176 /$0(1,7<7(55$&((1/$5*(0(176 /$0(1,7<7(55$&((1/$5*(0(176 /7(0325$5<*5((163$&( //$1'6&$3('(7$,/6 /'25$3/$1 City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 48 % $ $ / / 2 ) ) 3 3 7 7 6 6 3 8 8 2 6 *$0%/('5,9(3$5.3/$&(%/9'.(<6721(:$// $1'$662&,$7(' )281'$7,216 .(<6721(:$// $1'$662&,$7(' )281'$7,216 .(<6721(:$// $1'$662&,$7(' )281'$7,216 , ,, , , % %% % % % % % %% % % % %% & & && & & & & & & & & % % & & & % ' ' ' ' 9 9 * * * * * * * * )) ) ) ) ) * ) * ****** * * ) ) ) )) ) 5 5 5 5 $ $ $ $ $ $ ( ( ( + + + + , - - . . . . .8 ) 1 / / * *( 1 2 2 2 2 2 2 2 2 2 ) ) . $ & ) 3 3 3 3 - 1 1& % ) - & - 1 $ ) 1 1 6287+($672))6,7( '(02/,7,217+,63$*( % % % $ $ - * 1 ' 2 ) 4 3527(&7(;,67,1*67250&%&2175$&725 72$'-867&$67,1*720$7&+),1$/*5$'(6 &2175$&72572&225',1$7( $//'(02/,7,21$1' &216758&7,21$&7,9,7,(6 :,7+,13$5.3/$&(%/9':,7+ &,7<2)67/28,63$5.7<3 5(029($1'6$/9$*((;,67,1*%866+(/7(5 $1'$662&,$7('6,*1$*(&2175$&72572 &225',1$7(:,7+0(75275$16,7 7 7 6 6 3 &2175$&72572/2&$7($1'5(029(6(:(56(59,&(72*$0%/( 1276+2:135,25725(029$/&2175$&72572/2&$7(/,1($1'127,)<(1*,1((5,00(',$7(/<,)27+(5%8,/',1*6(59,&(6&211(&7727+,6/,1( 1 5 ) 8 8 8 8 $ 0 2 % % $ 0 *9 9 9 9 9 9 9 9 9 9 9 9 9 99 9 99 9 9 -- - % $ $ 6 6 6 6 6 6 66 4 &20081,&$7,21/,1(72%(5(/2&$7(' &2175$&72572&225',1$7(:,7+ 87,/,7<3529,'(58 8 6287+:(672))6,7( '(02/,7,217+,63$*( % $ 0 8 3 2 4 1 3 0 0 5(5287(*$6/,1(3(587,/,7<3/$1 / // / / / / 1 0 07 7 2 2 2 ( 0 0 , 3 5(675,3(&5266:$/. 3(56,7(3/$1 &2175$&725725(/2&$7( 75$16)250(5)253$5.'$/( '5%8,/',1*$1'5(5287(8* (/(&75,&,1&2857<$5' 5(029($1'&$3:$7(5/,1( $73523(57</,1(3(567 /28,63$5.67$1'$5'6 0 - 1 1& % % % % ) - & - 1 $ $ / 2 3 ) % % $ ) 4 (59,&(72*$0%/( 2&$7(/,1($1'127,)< &211(&7727+,6/,1( 4 - % $ 6 6 6 66 6 6 4 - 0 0 *03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?&'(023/$1GZJ-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,635(3$5(')256,7('(02/,7,213/$1&7(5$6Ă+(03(/5($/(67$7(67/28,63$5.01 7+(&2175$&725,65(63216,%/()257+('(02/,7,215(029$/$1' ',6326$/,1$/2&$7,21$33529('%<$//*29(51,1*$87+25,7,(62)$// 6758&785(63$'6:$//6)/80(6)281'$7,2163$5.,1*'5,9(6 '5$,1$*(6758&785(687,/,7,(6(7&68&+7+$77+(,03529(0(17621 7+(3/$16&$1%(&216758&7(')$&,/,7,(672%(5(029('6+$//%( 81'(5&877268,7$%/(0$7(5,$/$1'%528*+772*5$'(:,7+68,7$%/( &203$&7('),//0$7(5,$/3(57+(352-(&7'2&80(176 7+(&2175$&725,65(63216,%/()255(029,1*$//'(%5,6)5207+(6,7( $1'',6326,1*2)7+('(%5,6,1$/$:)8/0$11(5$1',1$&&25'$1&( :,7+/2&$/$1'67$7(5(*8/$7,2167+(&2175$&7256+$//2%7$,1$1< 5(48,5('3(50,76)25'(02/,7,21$1'',6326$/)5207+($335235,$7( /2&$/$1'67$7($*(1&,(6&2175$&7256+$//3529,'(&23,(62)7+( 3(50,7$1'5(&(,3762)',6326$/2)0$7(5,$/6727+(2:1(5$1' 2:1(565(35(6(17$7,9(,1&/8',1*7+(7<3(2)'(%5,6$1'/2&$7,21 :+(5(,7:$6',6326(' 7+(&2175$&7256+$//0$,17$,187,/,7<6(59,&(672$'-$&(17 3523(57,(6$7$//7,0(687,/,7<6(59,&(66+$//127%(,17(55837(' :,7+287$33529$/)5207+(&216758&7,210$1$*(5$1'&225',1$7,21 :,7+7+($'-$&(173523(57,(6$1'257+(&,7< 7+(&2175$&7256+$//&225',1$7(:,7+5(63(&7,9(87,/,7<&203$1,(6 35,25727+(5(029$/$1'255(/2&$7,212)87,/,7,(67+(&2175$&725 6+$//&225',1$7(:,7+7+(87,/,7<&203$1<&21&(51,1*3257,2162) :25.:+,&+0$<%(3(5)250('%<7+(87,/,7<&203$1< 6)25&(6$1' $1<)((6:+,&+$5(72%(3$,'727+(87,/,7<&203$1<)257+(,5 6(59,&(67+(&2175$&725,65(63216,%/()253$<,1*$//)((6$1' &+$5*(6 7+(/2&$7,2162)(;,67,1*87,/,7,(66+2:1217+(3/$1+$9(%((1 '(7(50,1(')5207+(%(67,1)250$7,21$9$,/$%/($1'$5(*,9(1)257+( &219(1,(1&(2)7+(&2175$&7257+((1*,1((5$6680(612 5(63216,%,/,7<)257+(,5$&&85$&<35,25727+(67$572)$1< '(02/,7,21$&7,9,7<7+(&2175$&7256+$//127,)<7+($))(&7('87,/,7< &203$1,(6723529,'(/2&$7,2162)(;,67,1*87,/,7,(6:,7+,1352326(' :25.$5($ (;,67,1*6(:(563,3,1*$1'87,/,7,(66+2:1$5(%$6('21$9$,/$%/( 5(&25'3/$1'$7$$1'25),(/'87,/,7<0$5.,1*6$1'$5(12772%( ,17(535(7('$67+((;$&7/2&$7,21$'',7,21$/810$5.('2%67$&/(6 0$<(;,67217+(6,7(9(5,)<(;,67,1*&21',7,216$1'352&((':,7+ &$87,21$5281'$1<$17,&,3$7('81'(5*5281')($785(6*,9(127,&( 72$))(&7('87,/,7<&203$1,(65(*$5',1*5(029$/2)6(59,&(/,1(6$1' &$3$1<$%$1'21('/,1(6%()25(35(&(',1*:,7+7+(352326(':25. (/(&75,&$/7(/(3+21(&$%/(:$7(5),%(5237,&$1'25*$6/,1(6 1((',1*72%(5(029('255(/2&$7('6+$//%(&225',1$7(':,7+7+( $))(&7('87,/,7<&203$1<$'(48$7(7,0(6+$//%(3529,'(')25 5(/2&$7,21$1'&/26(&225',1$7,21:,7+7+(87,/,7<&203$1<,6 1(&(66$5<723529,'($60227+75$16,7,21,187,/,7<6(59,&( &2175$&7256+$//3$<&/26($77(17,2172(;,67,1*87,/,7,(6:,7+,1$1< 52$'5,*+72):$<'85,1*&216758&7,21 &2175$&72508673527(&77+(38%/,&$7$//7,0(6:,7+)(1&,1* %$55,&$'(6(1&/2685(6(7&$1'27+(5$335235,$7(%(67 0$1$*(0(1735$&7,&(6$6$33529('%<7+(&216758&7,210$1$*(5 0$,17(1$1&(2)75$)),&&21752/6+$//%(&225',1$7(',1$&&25'$1&( :,7+7+(&,7<&2817<$1'67$7('27$61(&(66$5< &2175$&7256+$//0$,17$,1$&&(6672$'-$&(173523(57,(6'85,1* &216758&7,21$1'6+$//127,)<$'-$&(173523(57<2:1(56,)$&&(66 :,//%(,17(55837('25$/7(5('$7$1<7,0('85,1*&216758&7,21 35,25727+(67$572)'(02/,7,21,167$//(526,21&21752/%03 6,1 $&&25'$1&(:,7+7+((526,21 6(',0(17&21752/3/$166:333 &2175$&7250$</,0,76$:&87$1'3$9(0(175(029$/7221/<7+26( $5($6:+(5(,7,65(48,5('$66+2:1217+(6(&216758&7,213/$16%87 ,)$1<'$0$*(,6,1&855('21$1<2)7+(6855281',1*3$9(0(1725 &85%7+(&2175$&7256+$//%(5(63216,%/()25,765(029$/$1' 5(3$,5 7+(&2175$&7256+$//&225',1$7(:$7(50$,1:25.:,7+7+(&,7< :$7(5$1'),5('(3$570(17672(1685($'(48$7(),5(3527(&7,21,6 &2167$17/<$9$,/$%/(727+(6,7($1'6855281',1*3523(57,(6 7+528*+$//3+$6(62)&216758&7,21&2175$&725:,//%(5(63216,%/( )25$55$1*,1*3529,',1*$1<5(48,5(':$7(50$,16+872))6:,7+7+( &,7<$1<&2676$662&,$7(':,7+:$7(50$,16+872))6:,//%(7+( 5(63216,%,/,7<2)7+(&2175$&725$1'12(;75$&203(16$7,21:,//%( 3529,'(' ,17+((9(17$:(//,6)281'7+(&2175$&7256+$//&217$&77+( (1*,1((5$1'2:1(5,00(',$7(/<$//:(//66+$//%(6($/('%<$ /,&(16(':(//&2175$&725,1$&&25'$1&(:,7+67$7(5(48,5(0(176 ,17+((9(177+$781.12:1&217$,1(56257$1.6$5((1&2817(5('7+( &2175$&7256+$//&217$&77+(2:1(5$1'252:1(565(35(6(17$7,9( ,00(',$7(/<$//&217$,1(566+$//%(',6326('2)$7$3(50,77(' /$1'),//3(57+(352-(&7'2&80(176 &2175$&7256+$//127,)<7+((1*,1((5,)$1<(;,67,1*'5$,17,/(,6 (1&2817(5('216,7($&7,9('5$,17,/(6+$//127%(5(029(':,7+287 $33529$/)5207+((1*,1((5 ,)&217$0,1$7('0$7(5,$/,6(1&2817(5('217+(352-(&76,7(7+( &2175$&7256+$//6723:25.$1'127,)<7+(2:1(5$1'(1*,1((5 ,00(',$7(/< '(02/,7,213/$1127(6 /,0,762)&216758&7,21 5(029(%,780,1286685)$&( 5(029(&21&5(7(685)$&( 5(029(%8,/',1* 5(029(75(( 5(029(&21&5(7(&85% *877(5 5(029(87,/,7</,1(6 3523(57</,1( (;,67,1*29(5+($'32:(5/,1( (;,67,1*&+$,1/,1.)(1&( (;,67,1*5(7$,1,1*:$// (;,67,1*6$1,7$5<6(:(5 (;,67,1*672506(:(5 (;,67,1*:$7(50$,1 (;,67,1**$60$,1 (;,67,1*81'(5*5281'7(/(3+21( (;,67,1*81'(5*5281'&$%/( (;,67,1*&217285 (;,67,1*6,*1 (;,67,1*+<'5$17 (;,67,1*/,*+732/( (;,67,1*75(( (;,67,1*&85% *877(5 /(*(1' )8//'(37+6$:&87 /,0,762)&216758&7,21 5(029(%,780,1286685)$&( 5(029(&21&5(7(685)$&( 5(029(%8,/',1* 5(029(75(( 5(029(&21&5(7(&85% *877(5 5(029(87,/,7</,1(6 3523(57</,1( (;,67,1*29(5+($'32:(5/,1( (;,67,1*&+$,1/,1.)(1&( (;,67,1*5(7$,1,1*:$// (;,67,1*6$1,7$5<6(:(5 (;,67,1*672506(:(5 (;,67,1*:$7(50$,1 (;,67,1**$60$,1 (;,67,1*81'(5*5281'7(/(3+21( (;,67,1*81'(5*5281'&$%/( (;,67,1*&217285 (;,67,1*6,*1 (;,67,1*+<'5$17 (;,67,1*/,*+732/( (;,67,1*75(( (;,67,1*&85% *877(5 /(*(1' )8//'(37+6$:&87 .(<127(/(*(1' 6$:&873$9(0(17 5(029(&85% 5(029(6,'(:$/. 5(029(%8,/',1*6758&785( 5(029(6,*1 5(029($1'6$/9$*(6,7(/,*+7,1* &2175$&72572&225',1$7(:,7+ &,7<2:1(5,)72%(5(86('216,7( 5(029(6,7(/,*+7,1* 5(029(1$785$/*$6/,1( 5(029(:$7(5/,1(+<'5$179$/9( 5(029(6(:(5/,1(6758&785( 5(029((/(&75,&$//,1((48,30(17 &2175$&72572&225',1$7(:,7+;&(/ 3527(&71$785$/*$6/,1( 3527(&7:$7(5/,1(+<'5$179$/9( 3527(&76(:(5/,1(6758&785( 3527(&7(/(&75,&$//,1((48,30(17 3527(&787,/,7</,1(6758&785( 3527(&76,7(/,*+7,1* 3527(&7%8,/',1*6758&785( 3527(&7&85% *877(5 3527(&775(( 5(/2&$7(87,/,7</,1(6758&785( (48,30(17&2175$&72572&225',1$7( :,7+87,/,7<3529,'(5 5(029($1'6$/9$*((;,67,1*/$1'6&$3( 3/$=$(/(0(1763$9(56+$002&.32/(6 %(1&+(63/$17(563(5*2/$(7& &2175$&72572&225',1$7(:,7+2:1(5 21),1$//2&$7,21 $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 6287+:(672))6,7('(02/,7,21 6&$/( 6287+($672))6,7('(02/,7,21 6&$/( 127( &,7<2)67/28,63$5.),%(5237,&/,1( /2&$7(',11:&251(52)3523(57< &2175$&72572&225',1$7(:,7+7+(&,7< $1'5(/2&$7($61(&(66$5<)25 &216758&7,21 $//%8,/',1*6(59,&(6723$5.'$/('5 3$5.'$/('5$1'*$0%/('5$5(72 %(0$,17$,1('7+528*+287&216758&7,21 &2175$&72572&225',1$7(7(0325$5< 87,/,7<6(59,&(6$61(&&(66$5<$1'3+$6( &216758&7,21$6723529,'(&217,1286 6(59,&(72$'-$&(173523(57,(6 Page 49 3 3 3 $ . . 5$ *$0%/('5,9(3$5.3/$&(%/9'5(7$,/% ))( 5(7$,/& ))( 5(7$,/' ))( 5(7$,/$ ))( $37/2%%< ))( $0(1,7< 6) ))(6723123$5.,1*123$5.,1*123$5.,1*123$5.,1*123$5.,1* 352326('%866723$1' 6+(/7(5/2&$7,216(( $5&+,7(&785$/3/$16 )25025('(7$,/6 (;,67,1*%866723$1' 6+(/7(5/2&$7,216(( $5&+,7(&785$/3/$16 )256+(/7(5'(7$,/6 *$7('(175<758&. $&&(6621/< 6287+($672))6,7( $5($7+,63$*( 5 5 5 5 5 5 5 5 5 5 5 0 0 0 0 0 0 0 0 0 0 0 0 0000 0 0 3 3 3 3 3 3 3 3 3 + ' ( ' ( (( % % % $ $ $ $ $ $$ $ $ + + + + + + + + + ++ + + + . . . . . . . - - - - - - - - - - - 6 5 5 5 5 * * 4 4 1 1 1 1 22 2 2 2 2 2 8 8 8 287'2253$7,2 352326(''5232)) $1'/2$',1*=21( (;,67,1*67$,56 *(1(5$725 75$16)250(5 75$16)250(5$1' &211(&7,21&$%,1(7 5 5 5 5 - 1 / / 5 & & 12%2//$5' ( 0 0 5 5 5 5 5 5 5 5 5 5 $ $ - $ $ *$7('(175<758&. $&&(6621/< ) ) ) ) ) &12%2//$5' 1 2 , * * 67(36# :,'7+ +(,*+7 * - 0 0 0 9 67(36# :,'7+ +(,*+7 0 $ $ $ $ 0 6287+:(672))6,7( $5($7+,63$*( $ $ $ $ $$ 5 5 5 5 5 5 5 5 5 5 5 5 55555 5 5 5 9 1 2 2 5(86(6$/9$*('3$9(56)520'(02 ' 287'225$0(1,7<$5($ 352*5$0,1*63$&(:,7+ /,*+7,1*,03529(0(1766(( $5&+,7(&785$/3/$16)25 025('(7$,/6 + + + 1 3 ,1&+67$,56 75$6+67$*,1*6(( $5&+,7(&785$/3/$16 : : : ; ; ; 0 $ 5 5 5 5 5 * +$1'5$,/ < < ( 5 5 5 5 $ $ $ $ $ $ $ . - 5 5 5 $ - $ *03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?&6,7(3/$1GZJ-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,6 /(*(1' 6,7(3/$1127(6 5()(5727+($5&+,7(&785$/3/$16)25(;$&7/2&$7,216$1'',0(16,216 2)672236758&.'2&.675$6+(1&/2685(6 35(&,6(%8,/',1* ',0(16,2165()(5727+(6,7((/(&75,&$/3/$1)25/2&$7,2162)352326(' /,*+732/(6&21'8,76$1'(/(&75,&$/(48,30(17 5()(572&(57,),('6,7(6859(<253/$7)25(;$&7/2&$7,212)(;,67,1* ($6(0(1763523(57<%281'$5<',0(16,216$1'$'-$&(175,*+72):$< 3$5&(/,1)250$7,21 ',0(16,216$1'5$',,$5('5$:1727+()$&(2)&85%81/(6627+(5:,6( 127('',0(16,216$5(5281'('727+(1($5(677(17+)227$1'$5($6 $5(5281'('727+(1($5(67648$5()227 81/(6627+(5:,6(127('7+(&2175$&7256+$//%(5(63216,%/()25 5(/2&$7,1*(;,67,1*6,7(,03529(0(1767+$7&21)/,&7:,7+7+(352326(' :25.,1&/8',1*%87127/,0,7('7275$)),&6,*16/,*+732/(6 $%29(*5281'87,/,7,(6(7&3(5)250:25.,1$&&25'$1&(:,7+ *29(51,1*$87+25,7,(65(48,5(0(176$1'352-(&76,7(:25. 63(&,),&$7,216&2676+$//%(,1&/8'(',1%$6(%,' 7<3,&$/3$5.,1*67$//',0(16,2166+$//%()((7,1:,'7+$1')((7,1 /(1*7+81/(6627+(5:,6(,1',&$7(' $//352326('3$9(0(170$5.,1*621&,7<675((760867%(3(5)250('3(5 &,7<2)67/28,63$5.'(7$,/6$1'63(&,),&$7,21638%/,&&5266:$/.$1' $552:0$5.,1*60867%(*5281',17+(5023/$67,&$1'$//675,3,1*0867 %(087/,&203(32;< $//&,7<2:1('675((7/,*+76$1':,5,1*$/21*3$5.3/$&(%/9'25 *$0%/('57+$7$5(%(,1*5(/2&$7('6+$//%(5(,167$//('$&&25',1*72 &,7<36(&,),&$7,216&21'8,76+28/'%(86(')25675((7/,*+7:,5,1* $//675((7/,*+76217+(6287+6,'(2)*$0%/('5$1'7+(/,*+76217+( 1257+6,'(2**$0%/('5($672)'8.('5$5()('7+528*+7+(/,*+76 7+$7$5(%(,1*352326('72%(5(029('$1'6$/9$*('$/21*7+(1257+ 6,'(2)7+(3523(57<'2:17,0(6+$//%($60,1,0$/$63266,%/( 352326('&85%$1'*877(5 3523(57</,1( 6(7%$&./,1( 67$1'$5''87<$63+$/73$90(17 6(('(7$,/6)256(&7,21 +($9<'87<$63+$/73$9(0(17 6(('(7$,/6)256(&7,21 +($9<'87<&21&5(7(3$9(0(17 6(('(7$,/6)256(&7,21 67$1'$5''87<&21&5(7(3$9(0(176,'(:$/. 6(('(7$,/6)256(&7,21 (;7(1762)81'(5*5281'3$5.,1**$5$*(35(3$5(')256,7(',0(16,213/$1&7(5$6Ă+(03(/5($/(67$7(67/28,63$5.016287+:(672))6,7($5($ 6&$/( 6287+($672))6,7($5($ 6&$/( /(9(/%8,/',1*(;7(176 /,0,762)&216758&7,21 .(<127(/(*(1' 0$7&+(;,67,1*('*(2)3$9(0(17&85% *877(5 &200(5&,$/'5,9(:$<$35213(5&,7<2) 67/28,63$5.'(7$,/ $&&(66,%/(3$5.,1*6,*13(567$7(2) 0,11(627$$'$*8,'(/,1(6:,7+%2//$5' $&&(66,%/(3$5.,1*67$//$1'$&&(66 $,6/(3(567$7(2)0,11(627$$'$ *8,'(/,1(6 $5($675,3(':,7+6<6/# 2& +7',$&21&5(7(),//('3,3( %2//$5'&2/2572%(&21),50('%< $5&+,7(&76(('(7$,/ )/86+&85%$1'*877(5 /$1'6&$3($5($6((/$1'6&$3(3/$16 &21&5(7(9$//(<*877(56(('(7$,/ %&85% *877(5 %&85% *877(5 0$7&+(;,67,1*,17(56(&7,21%5,&. 3$9(563(5&,7<2)67/28,63$5. 67$1'$5'6 3('(675,$1&85%5$03 %,.(5$&.66((/$1'6&$3(3/$16 6,7(%(1&+(66((/$1'6&$3(3/$16 3$9(0(170$5.,1*6,1$&&25'$1&(:,7+ 087&'7<3 81'(5*5281'3$5.,1*/289(56 6,7(/,*+7,1* 67236,*15 5(,167$//675((7/,*+73(5&,7<2)67 /28,63$5.67$1'$5'6 (;,67,1*75$)),&6,*1$/,1)5$6758&785( 5(7$,1,1*:$//:,7++$1'5$,/'(6,*1%< 27+(56&2/2572%(6(/(&7('%< $5&+,7(&7 6&5((1:$//'(6,*1%<27+(56&2/25 72%(6(/(&7('%<$5&+,7(&7 &/$66(9&+$5*,1*67$7,2166((0(3 3/$16 68502817$%/(&85%$1'*877(5 $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < 5(3/$&(+$5'6&$3($61(('(')2587,/,7< &211(&7,2160$7&+(;,67,1*3$9(0(176(&7,216 3(5&,7<2)67/28,63$5.63(&,),&$7,216 6,7(/,*+7,1*6((3+2720(75,&3/$1 %8,/',1*6800$5< *5266648$5()227$*(6) )22735,17648$5()227$*(6) 5(6,'(17,$/81,76 81,76 %8,/',1*(/(9$7,216 *$5$*(3 67)/225/ 727$/+(,*+76725,(6 3$5.,1*6800$5< 180%(52)9(+,&/(63$&(6 63$&(6 180%(52)%,&<&/(67$//6 67$//6 *$5$*(3$5.,1* 67$1'$5'63$&(6 63$&(6 &203$&763$&(6 63$&(6 7$1'(063$&(6 63$&(6 /(9(/(963$&(6 63$&(6 $'$$&&(66,%/(63$&(6 63$&(6 %,&<&/(67$//6,1'22567$//6 685)$&(3$5.,1* 67$1'$5'63$&(6 63$&(6 &203$&763$&(6 63$&(6 /(9(/(963$&(6 63$&(6 $'$$&&(66,%/(63$&(6 63$&(6 %,&<&/(67$//6(;7(5,2567$//6 3523(57<6800$5< 727$/3523(57<$5($75$&7'$&6) ',6785%('$5($$&6) (;,67,1*,03(59,286$5($$& (;,67,1*3(59,286$5($$& 352326(',03(59,286$5($$& 352326('3(59,286$5($$& ,1&5($6(,1,03(59,286$5($$&6) 6,7('$7$ (;,67,1*=21,1*22)),&( 352326('=21,1*38' 352326('/$1'86(0,;('86( 9,6,%,/,7<75,$1*/()25,17(56(&7,21 ($6(0(17/,1(6((6+((7&)255()(5(1&( 2))6,7(,03529(0(176127,1&/8'(',138' $33529$/6 Page 50 5(7$,/% ))( 5(7$,/& ))( 5(7$,/' ))( 5(7$,/$ ))( $37/2%%< ))( $0(1,7< 6) ))(6723123$5.,1*123$5.,1*123$5.,1*123$5.,1*123$5.,1* *$0%/('5,9(3$5.3/$&(%/9'(;,67,1*&85%/,1( 72%('(02/,6+(' (;,67,1*&85%/,1( 72%('(02/,6+(' %866+(/7(5$5($ (1/$5*(0(177+,63$*( 352326('%866723$1' 6+(/7(5/2&$7,216(( $5&+,7(&785$/3/$16)25 6+(/7(5'(7$,/6 352326('/$1( 675,3,1*3(5 &,7<67$1'$5'6 352326('&85% 352326('75$16)250(5 $1'&211(&7,21&$%,1(7 *$7($506 3523(57</,1( 6&5((1:$// (;,67,1*%866723$1'6+(/7(5/2&$7,21 6+(/7(572%(6$/9$*('&2175$&725 72&225',1$7(:,7+0(75275$16,7 352326('%8667236,*1$*(6,*1$*($1' 32673529,'('%<0(75275$16,7&2175$&725 723529,'(&211(&7,2172&21&5(7( *03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?%8667233/$1GZJ-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,6 /(*(1'6,7(3/$1127(6 5()(5727+($5&+,7(&785$/3/$16)25(;$&7/2&$7,216$1'',0(16,2162)672236758&. '2&.675$6+(1&/2685(6 35(&,6(%8,/',1*',0(16,2165()(5727+(6,7((/(&75,&$/3/$1 )25/2&$7,2162)352326('/,*+732/(6&21'8,76$1'(/(&75,&$/(48,30(17 5()(572&(57,),('6,7(6859(<253/$7)25(;$&7/2&$7,212)(;,67,1*($6(0(1763523(57< %281'$5<',0(16,216$1'$'-$&(175,*+72):$< 3$5&(/,1)250$7,21 ',0(16,216$1'5$',,$5('5$:1727+()$&(2)&85%81/(6627+(5:,6(127('',0(16,216 $5(5281'('727+(1($5(677(17+)227$1'$5($6$5(5281'('727+(1($5(67648$5( )227 81/(6627+(5:,6(127('7+(&2175$&7256+$//%(5(63216,%/()255(/2&$7,1*(;,67,1*6,7( ,03529(0(1767+$7&21)/,&7:,7+7+(352326(':25.,1&/8',1*%87127/,0,7('7275$)),& 6,*16/,*+732/(6$%29(*5281'87,/,7,(6(7&3(5)250:25.,1$&&25'$1&(:,7+*29(51,1* $87+25,7,(65(48,5(0(176$1'352-(&76,7(:25.63(&,),&$7,216&2676+$//%(,1&/8'(',1 %$6(%,' 3523(57</,1( 67$1'$5''87<&21&5(7(3$9(0(176,'(:$/.35(3$5(')25%8667233/$1&7(5$6Ă+(03(/5($/(67$7(67/28,63$5.01352326('52$':$<3$9(0(17 %866+(/7(5$5($(1/$5*(0(17 6&$/( Page 51 '' '' ' ' ''' '''''''''''''''''' '''''''''''''''''''6723123$5.,1*123$5.,1*123$5.,1*123$5.,1*123$5.,1* 3$5.'$ / ( ' 5 , 9 ( *$0%/('5,9(3$5.3/$&(%/9''''''' 67250:$7(5 0$1$*(0(176<67(0 *03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?($6(0(17(;+,%,7GZJ-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,635(3$5(')25($6(0(173/$1&7(5$6Ă+(03(/5($/(67$7(67/28,63$5.013523(57</,1( /(*(1' 35*5((163$&(($6(0(17 353(50$1(1752$':$<'5$,1$*($1'87,/,7<($6(0(17 35$&&(66($6(0(17 35)76$1,7$5<6(:(5($6(0(17 35)7672506(:(5($6(0(17 35)7:$7(50$,1($6(0(17 35'5<87,/,7<($6(0(17 (;3(50$1(1752$':$<'5$,1$*($1'87,/,7<($6(0(17 Page 52 /$1'6&$3(/(*(1' ('*(57<3 $3352;,0$7(/,0,762)62'6(('62'$// ',6785%('$5($67<3 6(('62'('*(7<3 62'7<3 52&.08/&+ *5$<75$352&.7<3 &21735$,5,('5236(('#2& ,167(56(('(':35$,5,('5236((' 6(('7<3 (;7(1762)81'(5*5281'3$5.,1**$5$*( (;7(1762)%8,/',1*/(9(/ :22'(1%(1&+/$1'6&$3()2506 0XOWLSOL&,7<25$33529('(48$/7<3 %,.(5$&.:(673257126&5$7&+%,.( 5$&.25$33529('(48$/7<3 (;,67,1*75((67<3 /$1'6&$3(.(<127(6 ('*(57<3 '28%/(6+5(''('+$5':22'08/&+7<3 52&.08/&+7<3 62'7<3 $ % & ' 5(7$,/% ))( 5(7$,/& ))( 5(7$,/' ))( 5(7$,/$ ))( $37/2%%< ))( $0(1,7< 6) ))(6723123$5.,1*123$5.,1*123$5.,1*123$5.,1*123$5.,1* 550 .&< 48& .&< .62 48& 48& 48& %2/%2/ 48& 550 &62 550 .62 .62 48& 48& 48& 3(( %2/ %2/ .&< &62 550 550 550 .&< &62 &62 550550 .&< .&< 48& &62 &62 .&< %2/ 550 .62 48& 361 361 361 550 .62 .62 352326(' *5((163$&( 6) *$0%/('5,9(3$5.3/$&(%/9'6<0%2/ &2'( &200211$0( 29(56725<75(( %2/ %28/(9$5'/,1'(1 &62 &5,062163,5(2$. .&< (635(662.(178&.<&2))((75(( .62 .,1'5('63,5,72$. 3(( 35$,5,((;3(',7,21$0(5,&$1(/0 361 35$,5,(6(17,1(/+$&.%(55< 48& 48$.,1*$63(1&/803 550 5('52&.(70$3/( '(&,'82866+58%6 $%6 $87801%5,//,$1&($33/(6(59,&(%(55< $:9 $552::22'9,%85180 '%+ ':$5)%86++21(<68&./( *%& */266<%/$&.&+2.(%(55< */6 *52/2:)5$*5$17680$& /'1 /,77/('(9,/1,1(%$5. 0*' 086.,1*80*5$<'2*:22' 6(0 6(0)$/6(63,5($ (9(5*5((16+58%6 6*- 6($*5((1-81,3(5 7(5 7$</25($67(515('&('$5 251$0(17$/*5$66(6 %%% %/$&.+$:.6%,*%/8(67(0 )2* )2817$,1*5$66 +06 +($9<0(7$/6:,7&+*5$66 /%6 /,77/(%/8(67(0 16* 1257+:,1'6:,7&+*5$66 3'6 35$,5,('5236((' 3(5(11,$/6 $)6 $87801),5(6('80 $// 0,//(1,80251$0(17$/21,21 %(6 %/$&.(<('686$1 3%6 35$,5,(%/$=,1*67$5 3&) 3853/(&21()/2:(5 :/& :$/.(5C6/2:&$70,17 3/$17.(<*03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?//$1'6&$3(3/$1':*-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,6 /$1'6&$3(5(48,5(0(176 5(48,5(' 29(56725<(9(5*5((175((3(55(6,'(17,$/81,7 352326('727$/29(56725<75((6 3529,'('29(56725<75((6180%(52)3/$17,1*6 &$1127%(0(7'8(72+,*+'(16,7<2)'(9(/230(17 5(48,5(' 6+58%6 6+58%63(5(9(5<6)*5266)/225$5($ #6) 3529,'(' 6+58%6 75((0,7,*$7,21 180%(52)75((65(029(' 75((6 180%(52)75((72%(5(3/$&(' 75((6 6&5((1,1*5(48,5(0(176 5(48,5(' 6758&785(62))675((73$5.,1*:,7+,1 2)52: 5(6,'(17,$//2$',1*6(59,&($5($ 9(*(7$7,21)(1&(6:$//6%(50625&20%,1$7,2172%( $&&(37$%/( 3529,'(' 6((213/$16 5(48,5('%,.($0(1,7,(6 5(48,5('63$&(6 5(6,'(17,$/81,765(43$5.,1*; 5(7$,/5(43$5.,1*; 3529,'('(;7(5,2563$&(6$1',17(5,2563$&(6 127(%,.(5$&.67+$7)$//:,7+,17+(52:52$'($6(0(17:,//%( &225',1$7('72$/,*1:,7+352-(&7'(6,*1$1'63(&,$/6(59,&(',675,&7 5(&200(1'$7,216 &$/&8/$7('62,/5(6725$7,21287387 $5($2)6,7(72%(9(*(7$7('6) 81,7:(,*+72)72362,//%6&)/%6&) :(,*+72)62,/72'(37+72%($0(1'(' 7216 (;,67,1*3(5&(172)25*$1,&67(67(' :(,*+72)&2032671(('('7216 127($//62,/0867+$9($0,1,08025*$1,&0$7(5,$/%<62,/:(,*+7 7+528*+7+(,1&25325$7,212)86&203267&281&,/67$&(57,),('&203267 /$1'6&$3(6800$5<35(3$5(')25/$1'6&$3(3/$1/7(5$6Ă+(03(/5($/(67$7(67/28,63$5.011257+ / / / / Page 53 %2/ %2/ .&< 2/ 352326(' 6,'(:$/. '(&,'828675((,1 3/$17(57<3 352326(' *5((163$&( 6) %,.(5$&.7<3 $1&+25(':22'%(1&+ )851,6+,1*7<3 6,'(:$/. 3$9(565(/2&$7(' )52035(9,286 287'225$0(1,7<'(02 (;7(1762) 352326(' 323835,1.6723550 .&< 48& .&< .62 48& 48& 48& %2/%2/ 48& 550 &62 550 .62 .62 48& 48& 48& $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & $ % & % % % & $ % & ' ' ' ' ' ' $ % & & & & & $ % $ % & $ % & & % & 3(( %2/ %2/ .&< &62 550 550 550 .&< &62 &62 550550 .&< .&< 48& &62 &62 .&< %2/ 550 .62 48& 361 361 361 550 & & & & .62 .62 & 352326(' *5((163$&( 6) *$0%/('5,9(3$5.3/$&(%/9''(&,'828675((,13/$17(57<3 )/(;,%/(:22'%(1&+)851,6+,1*7<3 62'/$:17<3 &21&(37/(*(1'*03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?//$1'6&$3(3/$1':*-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,635(3$5(')257(0325$5<*5((163$&(/7(5$6Ă+(03(/5($/(67$7(67/28,63$5.01.(<0$3 127726&$/( 1257+ City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 54 5(7$,/% ))( 5(7$,/& ))( 5(7$,/' ))( 5(7$,/$ ))( $37/2%%< ))( $0(1,7< 6) ))(6723123$5.,1*123$5.,1*123$5.,1*123$5.,1*123$5.,1* %8,/',1* )22735,17 $0(1,7< 7(55$&( $5($7<3 $0(1,7< 7(55$&( $5($7<3 $0(1,7< 7(55$&( $5($7<3*03 (,67KLVGRFXPHQWWRJHWKHUZLWKWKHFRQFHSWVDQGGHVLJQVSUHVHQWHGKHUHLQDVDQLQVWUXPHQWRIVHUYLFHLVLQWHQGHGRQO\IRUWKHVSHFLILFSXUSRVHDQGFOLHQWIRUZKLFKLWZDVSUHSDUHG5HXVHRIDQGLPSURSHUUHOLDQFHRQWKLVGRFXPHQWZLWKRXWZULWWHQDXWKRUL]DWLRQDQGDGDSWDWLRQE\.LPOH\+RUQDQG$VVRFLDWHV,QFVKDOOEHZLWKRXWOLDELOLW\WR.LPOH\+RUQDQG$VVRFLDWHV,QF6+((7180%(5 .?7:&B/'(9?+(03(/?6W/RXLV3DUN01?'HVLJQ?&$'?3ODQ6KHHWV?/'25$3/$1':*-DQXDU\SP%<5(9,6,2161R'$7(.,0/(<+251$1'$662&,$7(6,1&(867,6675((768,7(673$8/013+21(:::.,0/(<+251&2035(/,0,1$5<127)25&216758&7,2138'$33/,&$7,21 (,638'$33/,&$7,215(68%0,77$/ (,638'$33/,&$7,215(68%0,77$/ (,6 352326(''25$63$&(6*5281'/(9(/$5($ '(6,*1('287'2255(&5($7,21$5($'25$/(*(1'35(3$5(')25'25$3/$1/7(5$6Ă+(03(/5($/(67$7(67/28,63$5.011257+ '25$5(48,5(0(176 727$/6,7($5($6) 5(48,5(''25$63$&( 6)2)727$/$5($ 3529,'('23(163$&($7 *5281'/(9(/6) 3529,'('7(0325$5<*5((1 63$&(6) 3529,'('$0(1,7<7(55$&( 63$&(6) 727$/3529,'(''25$ 63$&(6)2)727$/$5($ 127( $5($,1&/8'(6352326('*5((163$&(/2&$7('2175$&7& *$0%/('5,9(3523(57< &$/&8/$7('$5($6,1&/8'(7+26(:,7+6,7($0(1,7,(6,1&/8',1*6,7( )851,785(86$%/(23(163$&($'-$&(17/$1'6&$3,1*$0(1,7< 7(55$&(6(7& $0(1,7<7(55$&('25$63$&(6 6&$/( 352326(''25$63$&(67(0325$5<*5((163$&( 352326(''25$63$&(6$0(1,7<7(55$&(6 Page 55 9City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4Page 56 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 1 TRAVEL DEMAND MANAGEMENT PLAN West End Office Park Redevelopment Phase 1 St. Louis Park, MN Prepared for: Hempel Real Estate Prepared by: December 2024 City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 57 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 2 INTRODUCTION This document serves as the Travel Demand Management (TDM) Plan for Phase 1 of the West End Office Park redevelopment. As expressed in this document, Hempel Real Estate is committed to applying this TDM Plan to the proposed mixed-use development that will be Phase 1 of the overall West End Office Park redevelopment. The cities of St. Louis Park and Golden Valley have established an overlay zoning district and a joint task force to address congestion mitigation strategies. The Task Force reviews Travel Demand Management (TDM) Plans for development in the established I-394 overlay zoning district. The West End Office Park site lies within Zone A of the overlay district (City of St. Louis Park Code, Article IV, Sections 36-321 through 36-330). PROJECT DESCRIPTION The proposed development is located on the southeast corner of Park Place Boulevard & Gamble Drive, in St. Louis Park, Minnesota. The existing site is currently the West End Office Park, consisting of four (4) office buildings which would each be redeveloped in four separate phases. The full West End Office Park Redevelopment site is 9.73 acres, while the Phase 1 portion of the site as proposed by Hempel Real Estate is 3.31 acres. Hempel Real Estate is proposing a mid-rise residential building along with a retail. Phase 1 of the West End Office Park redevelopment would replace the northwest building (5401 Gamble Drive) and the portion of the parking lot on the property. Phases 2-4 of the West End Office Park redevelopment are expected to be completed at a later date and are likely to include a variety of land uses such as residential, office, retail, and restaurants. A Traffic Impact Analysis (TIA) has been completed for the proposed development. The TIA analyzed all four (4) phases of the West End Office Park redevelopment, but if plans for the future phases 2-4 deviate significantly from the TIA, an updated traffic analysis will likely be required. West End Office Park Redevelopment Phase 1 will include over 200 new residential units in a 6-story residential building. Furthermore, the inclusion of retail on the site will promote multi-use trips between the onsite residential and retail land uses. Bicycle and pedestrian activity will be further supported with landscaping, convenient sidewalks and crosswalks, and bicycle parking for each building, including secure, indoor bicycle parking for the residential building. EXISTING CONDITIONS AND ALTERNATIVE TRANSIT OPPORTUNITIES Pedestrian and Bicycle Currently, the nearby intersection of Park Place Boulevard & Gamble Drive is signalized with marked pedestrian crosswalks on each leg activated by pedestrian pushbuttons. Sidewalks are provided on most nearby roadways. According to the St. Louis Park 2040 Comprehensive Plan, there are minimal sidewalk gaps near the site. The proposed development will accommodate safe and efficient travel for pedestrians and bicycles throughout the site by providing dedicated pedestrian facilities along interior roadways to align with the surrounding areas. The site is located a near the Cedar Lake Trail, a bicycle and pedestrian pathway that runs from City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 58 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 3 downtown Minneapolis to Chanhassen and other southwestern suburban communities. Furthermore, Cedar Lake Road west of Park Place Boulevard has shared use paths with dedicated bike lanes on both sides of the roadway. There are plans to expand these off-street bike facilities along Park Place Boulevard where they would connect to existing bicycle facilities at Laurel Avenue to the north. Some sidewalks are separated from the street by green space, and others contain various urban design elements like potters, benches, street lighting, waste receptacles, and artistic bollards. Transit The area is currently served by several bus routes operated by Metro Transit. The routes that serve the area are listed below: Route 9: The route 9 bus serves the site along Park Place Boulevard and Wayzata Boulevard. This local bus service connects to Cedar Lake Road and travels west to County Road 73. It provides service into downtown Minneapolis in the east. It continues through downtown and terminates in south Minneapolis at the 46th Street Blue Line LRT Station. Service is offered seven days a week all year. Buses on this route run from approximately 5:00 AM to 1:00 AM during the week. The route contains 15-to-20-minute headways during rush hour, 30-minute headways midday and evenings, and 30-to-60-minute headways on the weekend. Route 645: The route 645 bus runs west from along 16th Street toward Park Place where it then turns northward and then eastward onto Wayzata Blvd, providing access to the park and ride facility here before continuing toward I-394 eastbound for access to downtown Minneapolis. To the west, the route travels through Minnetonka and Orono toward its terminus at the Mound Transit Center. It is a limited stop bus route and is offered Monday through Friday from approximately 5:30 AM to 10:00PM, on Saturdays from approximately 8:00 AM to 10:00 PM, and on Sundays from approximately 10:00 AM to 8:00 PM. The route utilizes 60-minute headways during the majority of operational time, with 30-minute headways offered during the AM and PM peak periods of weekdays. Route 25: The route 25 bus route offers limited service to the Cedar Trails Condominiums southeast of the proposed development. The route travels east toward downtown Minneapolis and then north toward the Northtown Transit Center in Blaine. The bus offers once daily service departing from the Cedar Trails Condominiums stop at around 7:15 AM with return service arriving at about 4:00 PM. These bus routes have been modified in recent years corresponding to the developments throughout the West End area creating an increased demand for public transit. As part of the roadway improvements for the site, a new transit shelter will be built along Park Place Boulevard. Surrounding Amenities The nearby West End area contains a variety of land uses mixing office, residential, and retail land uses. The Shops at West End located directly north of the site offers various boutiques and restaurants along with a movie theater. There are multiple supermarkets nearby, including a Costco to the west and a Cub Foods to the north and a variety of other retail stores throughout the area. There are multiple City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Drive - Ward 4Page 59 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 4 fitness centers nearby plus hotel and lodging options located in the northern portion of the West End area. The area is expected to provide residents numerous options for entertainment, shopping, restaurants, and other needs so as to promote usage of nearby amenities via walking or biking trips. IMPLEMENTATION OF REQUIRED ROAD IMPROVEMENTS A few roadway improvements were required by the West End Office Park redevelopment traffic study and will need to be completed for the opening of the development. The intersections in and around the project are expected to operate at acceptable (LOS D or better) levels of service with the redevelopment. Planned Road Improvements Park Place Boulevard: Add a northbound right turn lane for the delivery access and midblock vehicle access. Rebuild the transit stop along Park Place Boulevard Gamble Drive: Remove the existing access point nearest Park Place Boulevard. Modifications to the existing parking lot and landscaping for the remaining West End Office Park area will also be required. These improvements will be constructed by Hemple Real Estate. Planned Trail and Sidewalk Improvements Sidewalks along Park Place Boulevard and Gamble Drive within the West End Office Park area will be reconstructed partially. The sidewalks will be separated from the roadways with landscaping. GOAL AND PERFORMANCE MEASURES The overall goal of this plan is to reduce potential traffic congestion that will come with the proposed development. This will occur by maintaining or improving acceptable levels of service on the roadways within and adjacent to the project site, minimizing the projected number of trips through adjacent intersections during the PM peak hour, and continuously encouraging alternative transportation use within each component in the development. The general road improvements mixed with pedestrian amenities, bicycle infrastructure, and better transit service will all assist in achieving the goal. PROPOSED TDM STRATEGIES Hempel Real Estate in coordination with building managers will pursue the following objectives and strategies to achieve its Traffic Management Plan. Objectives and Strategies TDM Friendly Design Mixed Use Development: A retail and residential component have been proposed for Phase 1 of the West End Office Park Redevelopment. The site contains both residential and retail space which will promote multimodal trips within the site. The Shops at West End and the many other nearby retail and restaurants will also encourage residents to stay nearby for shopping, entertainment, and grocery needs. This will reduce the number of vehicular trips that leave the site in the PM peak hour. With the surrounding area containing office and residential areas, the proposed supermarket and retail will further encourage shared use among the greater West City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 60 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 5 End Area. Residential Component: In the I-394 Overlay Zoning District language for both St. Louis Park and Golden Valley, it is encouraged to develop residential uses within the corridor to reduce PM peak traffic volumes in one direction. This development includes a 6-story apartment building containing 221 dwelling units. Residents in these units will likely either be reverse commuting from areas other than the West End vicinity in the afternoon, or will be working in the nearby office buildings, thus helping reduce PM traffic congestion. Shared Parking: A mixed-use development of this type provides opportunities for shared parking among different uses, reducing the overall number of parking spaces needed on-site. The fully built out pedestrian infrastructure within the site will help site users access the shops and residences by walking instead of driving. There are large parking ramps north and east of the site which will help alleviate office parking concerns and spillover. Underground Residential Parking: The development plan calls for underground parking for residents in the apartment building, thus reducing parking conflicts in surrounding retail parking areas. Delivery Truck Reductions: Delivery Trucks will be encouraged to deliver between 10 PM and 8 AM. Trucks needed for any use on the site will enter at a proposed curb cut located approximately 200’ south of Gamble Drive. The northbound right turn lane here will be extended beyond the curb cut and the proposed access intersection to ensure flow into the site for trucks and vehicles is unimpeded. Garbage collection should be scheduled during the day to minimize impacts on residents and the public. Pedestrian Access: Bike and pedestrian activity will be encouraged with ample connections throughout the site, landscaping, and marked crosswalks. An emphasis will be placed on pedestrian connections within the development to ensure the safety and convenience of pedestrians. This will promote a walkable, bike-friendly development that will activate the street fronts. Bicycle Access: Wayfinding signs will direct bicycle riders to ride south to the Cedar Lake Trail. The residential building will provide secure biking stalls inside the building for residents. There are several off-site bike ways including the North Cedar Lake Regional Trail that runs from West End to Downtown Minneapolis. Once on site, bicycles can use the shared-use paths with marked crosswalks to get around. There will be approximately 70 public bicycle parking stalls throughout the site allowing for bicycle parking for retail customers, employees, and visitors of the residential building. The residential building will also provide a secure bike storage location. Participate with Regional TDM Organizations to Provide Information on Transportation Alternatives The property manager will coordinate with Metro Transit and officials from trail network entities to promote the availability of alternative modes of transportation for the site and provide up-to-date information to residents. Display transit and trail maps in locations within the residential building. Support and Promote Bicycling and Walking as Alternatives Build and maintain pedestrian-friendly space within development site. Prioritize pedestrian movements over automobile movements at intersections by designating crosswalks. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 61 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 6 Actively display updated biking information, such as commuting tips and trail maps, in the lobbies of each building. Provide secure indoor bicycle storage for residents and outdoor bike stalls near each building for visitors of the residential or retail. Reconstruct sidewalks along adjacent roadways to provide separation from roadways to improve comfort and experience of users. Support and Promote Transit as an Alternative The developer will offer transit schedule information in the lobby of the residential building to promote the use of nearby local bus routes. Reconstruct bus stop along Park Place Boulevard on the western side of the site with shelter and seating. Support and Promote Carpooling The developer should charge a fee for the parking ramp and not include the price in the residential leases. Look into providing a dedicated space for rideshare pickups and drop-offs. Monitoring Once residences are 75% occupied, send survey to residents to gather interest and supply information about alternative transportation. After 6 months of occupancy, property manager to survey tenant on transportation usage. Property manager will evaluate effectiveness of strategies and modify the plan accordingly. TDM IMPLEMENTATION PLAN Developer(s) will be responsible to implement this plan upon completion of the West End Office Park Phase 1 Development. These obligations will run with the land in the event that portions of the project are sold to third parties. The steps to plan implementation are outlined below: 1) Property manager will be trained to serve as transportation coordinators and to follow plan implementation. These persons will coordinate with each other and regional planning organizations to provide residents with up-to-date information and promote the availability of alternative forms of transportation. 2) Once the residential building is 75% occupied, the property manager will conduct a survey to estimate participation in alternative modes of transportation. 3) The property manager will work with Metro Transit to inform all residents regarding all alternative transportation options available to them. City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 62 West End Office Park – St. Louis Park, MN Travel Demand Management Plan │ December 2024 7 TRAVEL MANAGEMENT MEASURE STATUS TARGET DATE TDM Friendly Design Mixed Use Development – establish uses with separate peak traffic flows 2027 Pedestrian Access – establish good sidewalk connections 2027 Bicycle Access – establish good biking infrastructure 2027 Underground Residential Parking— Provide secure underground parking to residents. 2027 Delivery Truck Reduction – All deliveries to use the designated truck access point and to be discouraged between 2027 TDM Organization Collaboration Display non-vehicular transportation information 2027 Promote Walking & Biking Build and maintain good pedestrian spaces 2027 Actively update walking & biking information within building lobbies 2027 Provide secure indoor bicycle storage for residents. 2027 Reconstruct sidewalks within the site with separation from adjacent roadways. 2027 Promote Transit Use Provide transit schedule information in the lobby of the residential building. 2027 Have managers facilitate selling bus passes to residents. 2027 Promote Carpooling Charge a fee for parking in the parking ramp. 2027 Look into providing dedicated areas for rideshare pickups and drop-offs 2027 Monitoring Send commuting survey to residents once building is 75% occupied 2028 Evaluate effectiveness of strategies and modify plan in coordination with concierges, CBC, and officials from the City of St. Louis Park 2029 City council meeting of February 3, 2025 (Item No. 7a) Title: Terasă planned unit development and West End Office Park special permit amendment and conditional use permit – 5401 Gamble Drive - Ward 4 Page 63 Meeting: City council Meeting date: February 3, 2025 Action agenda item: 7b Executive summary Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Recommended action: Motion to adopt resolution accepting the project report, establishing the 2025 Pavement Management project (4025-1000), approving plans and specifications and authorizing advertisement for bids. Policy consideration: Does the city council wish to pursue the pavement rehabilitation, utility improvements and sidewalk installation recommended as a part of this project? Summary: The annual Pavement Management project rehabilitates several miles of local residential streets. In 2025, the streets to be rehabilitated are in Pavement Management Area 3 (Cedar Manor, Westwood Hills and Kilmer Pond neighborhoods). Street rehabilitation work consists of replacing the existing bituminous pavement, concrete curb and gutter replacement, and storm and sanitary sewer repairs. In addition to reconstructing existing infrastructure, a new sidewalk segment is being recommended as part of this project. A public hearing was held at the Jan. 21, 2025 council meeting. The linked discussion provides information addressing questions that were presented during the public hearing or thereafter. Financial or budget considerations: This project is included in the city's 2025 capital improvement plan (CIP) and will be paid for using franchise fees, utility funds and other local sources. The total cost estimate for the project is $3,207,350. The breakdown of the estimate is in the Jan. 21 public hearing report. Strategic priority consideration: St. Louis Park is committed to providing a variety of options for people to make their way around the city comfortably, safely and reliably. Supporting documents: Discussion Resolution Attachment #1 - Project map including staff recommendations Attachment #2- Sidewalk segment matrix Jan. 6, 2024 study session report Jan. 21, 2024 public hearing report Prepared by: Aaron Wiesen, project engineer Reviewed by: Debra Heiser, engineering director; Amelia Cruver, finance director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 7b) Page 2 Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Discussion Background: This year's project will be performed in Area 3 of the city's eight pavement management areas. It includes work in the Cedar Manor, Westwood Hills and Kilmer Pond neighborhoods. Information regarding this project was shared with the city council in a written report at the Jan. 6, 2025 study session. The study session report, which includes recommendations for the elements to include in this project, is linked. A summary of the information in the report: • Description of the project scope • Sidewalk segment matrix and recommendations An overview of the recommended design and financial considerations for this project was presented at the Jan. 21, 2025 city council meeting. The mayor opened the public hearing, inviting members of the public to speak regarding the recommended design. One resident spoke during the public hearing. The following is a summary and staff response to this question: 1) The project should include additional improvements such as traffic management and street rightsizing. Traffic management In 2019, the city council approved the Living Streets policy. This policy guides the scope of our transportation project development. It is not meant to be a prescriptive "one size fits all" policy covering every contingency. Instead, it establishes principles that will be applied to each project as it goes through the planning and design process. One of the Living Streets principles is traffic management. At the beginning of the public process for a project, a postcard will be sent out with a link to an interactive map. The interactive map is an opportunity for community members to express their traffic, drainage and sidewalk concerns. In addition, the city will collect data on existing traffic conditions (e.g., volumes, speeds, on-street parking utilization). After reviewing the feedback and data, staff looks to see if there is a shared concern, supported by data, regarding traffic behavior. If one is found, the city will develop a traffic pilot project to test potential solutions or propose traffic control changes. As a part of the 2025 PMP public process, no traffic concerns were raised that could be addressed by implementing a traffic management measure or additional traffic controls, so a pilot project was not conducted. Street rightsizing When the city rehabilitates a street and the curb requires removal and replacement, due to poor condition or utility reconstruction, staff will take the opportunity to recommend street rightsizing. Usually, this results in reducing the street width. Doing so is consistent with the Living Streets Policy traffic management and stormwater management principles. There is no watermain replacement in this project that would require curb removal, and the existing curb is in good condition. Therefore, there was no opportunity to evaluate changes to the existing street widths and it was not pursued as a part of this project. City council meeting of February 3, 2025 (Item No. 7b) Page 3 Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Financial or budget considerations: The total cost estimate for the project is $3,207,350. Additional information on the breakdown of the funding can be found in the Jan. 21 public hearing report. Overall, the engineer's estimate is lower than CIP; however, the sanitary sewer cost is higher than the CIP. In addition, there is a significant reduction in the amount of general obligation bonds needed to build the project. Staff will monitor the bid process and determine if the changes from budget are significant enough to warrant a budget amendment. Bids for this project will be opened in March; once we have the contractors' bid, staff will finalize the overall funding package and bring forward a budget amendment resolution for council approval as a part of the bid award council action. Operations and maintenance costs: This project creates new city infrastructure, including neighborhood sidewalks (property owner responsible for snow removal). There are no additional community sidewalks (city snow removal) being added as part of this project. There will be long-term costs associated with the repair of sidewalks in the future. However, funding for concrete sidewalk repairs is included in the capital improvement plan and is adjusted annually based on inflation and need. Next steps: The proposed schedule for the project to facilitate construction completion in 2025 is as follows: Council project approval Feb. 3, 2025 Council awards construction bids April 2025 Construction May to November 2025 City council meeting of February 3, 2025 (Item No. 7b) Page 4 Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Resolution No. 25-___ Accepting the project report, establishing Improvement Project No. 4025-1000, approving plans and specifications and authorizing advertisement for bids for Improvement Project No. 4025-1000 Whereas, the city council of the City of St. Louis Park has received a report from the project engineer related to the 2025 Pavement Management Program, Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota, that: 1. The project report regarding Project No. 4025-1000 is hereby accepted. 2. Such improvements as proposed are necessary, cost-effective and feasible, as detailed in the project report. 3. The proposed project, designated as Project No. 4025-1000, is hereby established and ordered. 4. The following new sidewalk segments are hereby established and ordered for construction: Segment number Description Sidewalk Classification 1 Boone Avenue – east side (Cedar Lake Road to 25th Street) Neighborhood sidewalk (Resident) 5. The plans and specifications for the making of these improvements, as prepared under the direction of the engineering director, or designee, are approved. The engineering director is allowed to make adjustments to these plans and specifications, such as narrowing the width of boulevards or sidewalks, in cases where special circumstances exist in the field, such as the location of trees, provided that these adjustments will make a material difference in addressing any special circumstances that may exist. 6. The city clerk shall prepare and cause to be inserted at least two weeks in the official city newspaper and in relevant industry publications an advertisement for bids for the making of said improvements under said approved plans and specifications. The advertisement shall appear not less than 10 days prior to the date and time bids will be received electronically by the project manager and accompanied by a bid bond payable to the city for five (5) percent of the amount of the bid. The electronic bids will only be available to view after the bids are closed and the city receives the passcode from the bidding host site. City council meeting of February 3, 2025 (Item No. 7b) Page 5 Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 7. The project manager, or designee, shall report the receipt of bids to the city council shortly after the opening date. The report shall include a tabulation of the bid results and a recommendation to the city council. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk Minneapolis Golf ClubMinneapolis Golf Club Cedar Manor/Lake Park Cedar Manor/Lake Park Texa-Tonka/Lake Victoria Park Texa-Tonka/Lake Victoria Park Westwood Hills Nature Center Westwood Hills Nature Center Ford ParkFord Park CEDAR LA K E R D CEDAR LA K E R DHIGHWAY 169HIGHWAY 16916T H ST W 16T H ST W TEXAS AVE STEXAS AVE SWAYZATA BLVDWAYZATABLVD VIRGINIA AVESVIRGINIA AVESINTE RSTAT E 394 INTE RSTAT E 394 24TH ST W24TH ST W VICTORI A W A Y VICTORI A W A Y 25TH S T W25TH S T W 22ND S T W22NDSTWFORD RDFORD RDFLAG AVE SFLAG AVE S28TH ST W28TH ST W 25TH ST W 25TH ST W ZINRAN AVE SZINRAN AVE SFRANKLI N AVE W FRANKLI N AVE W UTAHDRUTAHDRRUNNYMEADE LNRUNNYMEADE LN WESTWOOD HILLSDRWESTWOOD HILLSDR29 TH ST W 29 TH ST W 26TH ST W26TH ST W18TH ST W18TH ST WHI L L S BOR OAVE SHI L L S BO R OAVE S PARKER RDPARKERRD FRANKLIN AVE WFRANKLIN AVE W BOONEAVE SBOONEAVE SFLAGAVESFLAGAVESINDEPENDENCEAVESINDEPENDENCEAVESWESTMORELAND LN WESTMO RELAND LN VIRGINIAAVE SVIRGINIAAVE S 16TH S T W16TH S T W 28TH S T W 28TH S T WMELROSEAVE SMELROSEAVE SSUMTERAVESSUMTERAVESSTANLEN RDSTANLEN RD XYLONAVESXYLONAVESCLUB RDCLUB RD BOONE AVE SBOONE AVE SVIRGINIA CIR NVIRGINIA CIR N TEXAS CIRTEXAS CIR 23RD ST W 23RD ST W 24TH LN W 24TH LN W 24TH ST W 24TH ST W 22ND ST W 22ND ST W BURD PLBURD PLWESTWOOD HILLS RDWESTWOOD HILLS RDGETTYSBURGAVE SGETTYSBURGAVE SPARKERLNPARKERLNXYLONAVE SXYLONAVE SVIRGINIA CIR SVIRGINIA CIR S 22ND LN W22ND LN W 23RD ST W23RD ST W JORDANAVESJORDANAVES22ND ST W22ND ST W WESTWOODHIL L S CU RVEWESTWOODHIL L S CU RVE 28TH ST W 28TH ST W 0 1,000 2,000500 Feet ´ Attachment #1- 2025 Pavement Management Project Staff Recommendations Sidewalk - staff recommended Street rehabilitation Street rehabilitation and sanitary sewer replacement Updated 12/9/2024 M i n n e t o n k aM i n n e t o n k a S t . L o u i s P a r k S t . L o u i s P a r k G o l d e n V a l l e yG o l d e n V a l l e y City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Page 6 Attachment #2 – Sidewalk Segment Matrix Segment #1 Boone Avenue – East Side (Cedar Lake Road to 25th Street) Data: Traffic volumes 339 vehicles/day Design: Right of way (ROW) width 50 feet Street width 30 feet Boulevard width (distance from back of curb to ROW line) 9 feet Permanent easement required None Proposed boulevard width 3 feet Proposed concrete sidewalk width 5 feet Proposed sidewalk length 220 feet Existing sidewalk length 0 feet Snow removal responsibility Neighborhood sidewalk Impacts: Trees in boulevard 1 Trees removed 1 (diameter of 6 inches) Properties adjacent to proposed sidewalk 3 Landscaping impacted None Retaining walls impacted None Retaining walls proposed None Private utility relocations None Miscellaneous None Financial: Construction cost $42,322 *Updated from Jan. 6 study session Cost per liner foot of new sidewalk $192.37/LF *Updated from Jan. 6 study session Staff recommendations: Build in 2025? Yes City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Page 7 � Outlook Re: Request for Reconsideration of Proposed Sidewalk Installation on Boone Ave S From Tim Brausen <TBrausen@stlouisparkmn.gov> Date Mon 2/3/2025 2:40 PM To Cc Kim Keller <KKeller@stlouisparkmn.gov>; Cindy Walsh <CWalsh@stlouisparkmn.gov>; Amanda Scott-Lerdal <AScottLerdal@stlouisparkmn.gov>; Debra Heiser <DHeiser@stlouisparkmn.gov>; Aaron Wiesen <AWiesen @stlouisparkmn.gov> -thank you for contacting me about this issue. Our City is enhanced by an active citizenry willing to share their concerns and opinions wi th their public officials. By copy of this response I am sharing your email with City st aff, along with a request that they forward it to my colleagues prior to tonight's City Council meeting. This project is on the City Council agenda tonight for approval as pro posed, and to date I had not heard any opposition to this proposed sidewalk segment. I'll get another look at it today, and we'll discuss it tonight prior to making a final decision. I'm sorry I won't have time to meet you at the property, though I appreciate the offer. Please know that I support the goals and policies of our Connect the Park Program in looking to make the city more walkable and bike-friendly while providing for multi-modal transportation. Whether this segment is a necessary part of this system is something we wil l examine before making a final decision. As always, we'll try to do wh at's best for the residents of our City. Regards, Timn Tim Brausen Saint Louis Park City Council Member, Ward 4 Sent from my iPad On Jan 30, 2025, at 4:59 PM, wrote: CAUTION: This email originated from outside of the organization. Do not click links or open attachments unless you recognize the sender and know the content is safe. Dear Mr. Brausen, I hope this message finds you well. I am writing to express my concerns regarding the proposed sidewalk installation at 2501 Boone Ave S, as part of the city's sidewalk improvement project. While I underst and and support the city's goals of improving City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) - Ward 4 Page 8 pedestrian safety, connectivity, and accessibility, I believe there are several important reasons why this particular project should be reconsidered. 1.Minimal Pedestrian Demand & Low Traffic Speeds The project team conducted a speed test in front of my house, and it was found that the average traffic speed is only 16 mph, well below the posted 25 mph speed limit. This suggests that pedestrians can already move safely along the street, particularly given the low traffic volume and slow speeds. As a result, the need for a new sidewalk seems minimal in this area compared to other parts of the city where pedestrian safety is a more pressing concern. 2.Poor Maintenance of Existing Sidewalks & Focus on Infrastructure Improvements During a conversation with the project manager, it became clear that the existing sidewalks on Boone Ave and 25th Street had not been properly evaluated as part of the project. These sidewalks are narrow, poorly maintained, and in disrepair, making them difficult and unsafe to use, particularly for people with disabilities. Furthermore, the sidewalks on 25th Street are currently not in compliance with the Department of Transportation's standards, which require a minimum 5-foot width if set back from the curb. Instead of adding new sidewalks in low traffic areas like Boone Ave, I believe the city should focus resources on repairing and improving the existing sidewalk infrastructure. This would better address pedestrian safety concerns and provide more lasting benefits to the community. 3.Environmental Impact & Loss of Trees I am also concerned about the potential loss of two trees in my yard that are located near the proposed sidewalk path. These trees are important to the overall environmental quality of the neighborhood, providing shade, improving air quality, and contributing to the aesthetic appeal of the area. The proposed sidewalk would likely encroach on the roots of these trees, putting them at risk of being damaged or dying. This loss of greenery would be detrimental to the neighborhood’s environment and overall character. 4.Impact on Taxpayer Resources Given that the new sidewalk would only serve a small area and that the estimated cost of the project is $10,500, I believe the city should allocate these resources more effectively. Investing in projects that address more pressing pedestrian safety issues or focus on improving the current infrastructure would provide a greater return on investment for taxpayers. 5.Cedar Lake Road Sidewalk & Limited Pedestrian Use It’s also important to consider that Cedar Lake Road already has a continuous sidewalk, meaning any pedestrians who turn down 25th Street would be walking to an area that lacks continuity with the rest of the city's sidewalk system. Those pedestrians are unlikely to continue walking down Club Road due to the absence of sidewalk infrastructure. In this City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) – Ward 4 Page 9 context, the proposed sidewalk on Boone Ave would serve a very limited number of people—those intentionally turning onto 25th Street, but with no continuation on Club Road. This further reduces the utility and effectiveness of the proposed sidewalk. 6. Existing Infrastructure and Access to Regional Trails St. Louis Park is already served by an extensive network of 116 miles of sidewalks and over 100 trails covering 889 miles, providing ample access to the city’s parks and regional trails. Moreover, the city is consistently ranked among the top 3 most walkable cities. This walkability score highlights the effectiveness of the city's existing pedestrian infrastructure, which already provides convenient access to recreational areas and other destinations. Given this robust network, the need for an additional sidewalk in this low- traffic area is minimal, and the focus could better be placed on ensuring that the existing infrastructure is safe, well-maintained, and fully accessible. In conclusion, while I fully support the city’s efforts to improve pedestrian infrastructure, I believe this particular sidewalk project may not be the most effective or efficient way to achieve those goals. I respectfully request that the city reconsider this proposal and prioritize the maintenance and improvement of existing sidewalks, which would have a more significant impact on pedestrian safety and connectivity throughout the community. Thank you for your time and consideration. I would like to invite you to meet me at my house on Boone Avenue to look at the impact of this project and discuss further why sidewalk on this street does not advance the city's effort to improve pedestrian infrastructure. I look forward to hearing from you and would welcome the opportunity to discuss these concerns further. Sincerely, City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) - Ward 4 Page 10 1 Aaron Wiesen Subject:RE: Art Partners Group; Raleigh/West 35th Project From: Sent: Wednesday, January 29, 2025 8:19 AM To: Lynette Dumalag <LDumalag@stlouisparkmn.gov> Cc: Subject: Art Partners Group; Raleigh/West 35th Project CAUTION: This email originated from outside of the organization. Do not click links or open attachments unless you recognize the sender and know the content is safe. Good morning Council Person Dumalag. I hope I’m not too late to write before your Feb3 meeting. I’m providing a quick summary of my comments/concerns during the Jan21 meeting. Our small company has been operating at the location directly across from the Post Office on Raleigh since 2013. At this location we have approximately 28 employees departing, five service vehicles departing and numerous delivery/pick-up companies including semi-trailers from 48-53’ long. My concerns covered during the meeting were around Safety and Cost. The vehicles (cars to semis) parked on both, or just one, side(s) of the street cause visual blocking leaving our driveways and the Post Office; semis 13-14’ high. The addition of a sidewalk on east side of Raleigh adds one from across the street on west side. Is this necessary in a non-residential area? Added cost to city to install, and to our company to maintain. I probably could count on one hand number of times I’ve seen anyone walking on west sidewalk next to Post Office. If this street goes down 6.5’ of width how can our semi’s make that turn without driving on our lawn? It is already an issue with two lanes with vehicles (cars and semis) parked on the west side. Our lawn would turn into a surface of mud ruts. There have been times I leave my office to direct traffic on Raleigh so a semi can get safely onto the street. And it’s extremely tight already. Side bar: there is a tractor/trailer directly across from us I believe has been sitting there since early January. There is a tractor just north of the Post Office for same amount of time. Should these oversized commercial vehicles be limited to between 7:00 p.m. to 7:00 a.m.? Thank you for your attention to these concerns. Best, I ART PARTNERS GROUP I 3529 Raleigh Ave., St. Louis Park, MN 55416 c r e a t e I v i s i o n I e x p e r i e n c e www.artpartners.com City council meeting of February 3, 2025 (Item No. 7b) Title: Resolution establishing the 2025 Pavement Management project (4025-1000) - Ward 4 Page 11 Meeting: City council Meeting date: February 3, 2025 Action agenda item: 7c Executive summary Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Recommended action: Motion to adopt resolutions: • Accepting the project report, establishing the 2025 Commercial Street Rehabilitation project (4025-1050), approving plans and specifications and authorizing advertisement for bids. • Rescind Resolution No. 03-075, removing existing parking restrictions on 35th Street. • Authorizing parking restrictions on Raleigh Avenue and 35th Street to provide safe and efficient vehicle travel. Policy consideration: Does the city council wish to pursue the pavement rehabilitation, utility improvements, sidewalk installation and impervious reductions recommended as a part of this project? Summary: In 2025, the city will be reconstructing streets in the Wolfe Park neighborhood, including Raleigh Avenue and 35th Street. The project includes street reconstruction, utility improvements, curb replacement, street lighting and street rightsizing. In addition to reconstructing existing infrastructure, new sidewalk segments are being recommended as part of this project. A public hearing was held at the Jan. 21, 2025, council meeting. The attached discussion provides information addressing questions that were presented during the public hearing or thereafter. Financial or budget considerations: This project is included in the city's 2025 capital improvement plan (CIP) and will be paid for using franchise fees, utility funds and other local funds. The total cost estimate for the project is $3,123,400. The breakdown of the estimate is in the Jan. 21 public hearing report. Strategic priority consideration: St. Louis Park is committed to providing a variety of options for people to make their way around the city comfortably, safely and reliably. Supporting documents: Discussion Resolutions Resolution No. 03-075 to be rescinded Attachment #1: Project map with staff recommendations Attachment #2: Sidewalk segment matrix Attachment #3: Proposed parking restrictions map Attachment #4: Community member feedback Jan. 6, 2025 study session report, Jan. 21, 2025 public hearing report Prepared by: Aaron Wiesen, project engineer Reviewed by: Debra Heiser, engineering director; Amelia Cruver, finance director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 7c) Page 2 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Discussion Background: In 2025, the city will be reconstructing streets in the Wolfe Park neighborhood, including Raleigh Avenue and 35th Street. Information regarding this project was shared with the city council in a written report at the Jan. 6, 2025 study session. The study session report, which includes recommendations for the elements to include in this project, is linked. A summary of the information in the report: • Description of the project scope • Sidewalk recommendations • Street width recommendations • Proposed parking restriction recommendations An overview of the recommended design for this project was presented at the Jan. 21, 2025 city council meeting. The mayor opened the public hearing, inviting members of the public to speak regarding the recommended design. Two residents spoke during the public hearing. The following is a summary and staff responses to the questions from the public hearing and from council members: 1) Is there a need for a sidewalk on the east side of Raleigh Avenue when there is a sidewalk on the west side? As a part of project development, staff reviewed the existing sidewalk system. New sidewalks were evaluated for potential construction to close gaps and create a well- connected and equitably distributed sidewalk network. Raleigh Avenue/35th Street has higher traffic volumes and numerous commercial destinations. There are existing sidewalk segments on this street, but they are not continuous. Consistent with the sidewalk planning framework, a goal is to fill in gaps in the existing sidewalk network on both sides of Raleigh Avenue/ 35th Street. For these reasons, staff evaluated sidewalks on both sides of Raleigh Avenue/35th Street. In addition, having continuous sidewalks on both sides of the street is consistent with the recommended design from the Arrive + Thrive Gateway plans for Raleigh Avenue and 35th Street. 2) What about safety with sight lines existing at the post office with trucks and trailers on the west side of Raleigh Avenue? Currently, truck parking is allowed on Raleigh Avenue. City ordinance prohibits parking within five (5) feet of any driveway or entrance to businesses. However, even at five feet, on-street parking by larger trucks limits sight lines for vehicles leaving the post office driveways. Staff will be reaching out to community members in spring 2025 for additional feedback regarding the truck parking in this area and will bring any changes to the council. 3) What about the ability of trucks and trailers to get in and out of businesses with reduced street width and trucks/trailers parked on the west side of the street. Raleigh Avenue/ 35th Street are roads that have many commercial land uses that require adequate turning movements for trucks accessing their driveways. Staff have reviewed truck turning movements into properties on Raleigh Avenue and 35th Street and have City council meeting of February 3, 2025 (Item No. 7c) Page 3 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 modified the radius of entrances or proposed additional parking restrictions to address potential truck turning movement conflicts. Financial or budget considerations: The total cost estimate for the project is $3,123,400. Additional information on the breakdown of the funding can be found in the Jan. 21 public hearing report. Overall, the engineer's estimate is lower than CIP; however, the sanitary sewer cost is higher than the CIP. In addition, the amount of general obligation bonds needed to build the project as recommended is lower. Staff will monitor bids and determine if a budget amendment is needed. Bids for this project will be opened in March; once we have the contractors' bid, staff will finalize the overall funding package and bring forward a budget amendment resolution for council approval as a part of the bid award council action. Operations and maintenance costs: This project creates new city infrastructure, including neighborhood sidewalks (property owner responsible for snow removal). There are no additional community sidewalks (city snow removal) being added as part of this project. There will be long-term costs associated with the repair of sidewalks in the future. However, funding for concrete sidewalk repairs is included in the capital improvement plan and is adjusted annually based on inflation and need. Next steps: The proposed schedule for the project to facilitate construction completion in 2025. Council project approval Feb. 3, 2025 Council awards construction bids April 2025 Construction May to November 2025 City council meeting of February 3, 2025 (Item No. 7c) Page 4 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Resolution No. 25-020 Accepting the project report, establishing Improvement Project No. 4025-1050, approving plans and specifications and authorizing advertisement for bids for improvement Project No. 4025-1050 Whereas, the city council of the City of St. Louis Park has received a report from the project engineer related to the 2025 Commercial Street Rehabilitation project, Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota, that: 1. The project report regarding Project No. 4025-1050 is hereby accepted. 2. Such improvements as proposed are necessary, cost-effective and feasible, as detailed in the project report. 3. The proposed project, designated as Project No. 4025-1050, is hereby established and ordered. 4. The following new sidewalk segments are hereby established and ordered for construction Segment number Description Maintenance responsibility 1 Raleigh Avenue / 35th Street – east/south side (36th Street to 340 feet west of Beltline Blvd) Neighborhood sidewalk (Property owner) 2 Raleigh Avenue / 35th Street – west/north side (35th Street to 340 feet west of Beltline Blvd) Neighborhood sidewalk (Property owner) 5. The following street widths are hereby established and ordered for construction The following are the recommended street width changes: Street segment Existing (ft) Proposed (ft) Raleigh Avenue / 35th Street (36th Street to 340 feet west of Beltline Boulevard) 40 33.5 35th Street (Raleigh Avenue to dead end) 40 33.5 The following streets are recommended to stay at their current width: Street segment Existing (ft) Proposed (ft) Raleigh Avenue / 35th Street (340 feet west of Beltline Boulevard to Beltline Boulevard) 40 40 City council meeting of February 3, 2025 (Item No. 7c) Page 5 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 6. The plans and specifications for the making of these improvements, as prepared under the direction of the engineering director, or designee, are approved. The engineering director is allowed to make adjustments to these plans and specifications, such as narrowing the width of boulevards or sidewalks, in cases where special circumstances exist in the field, such as the location of trees, provided that these adjustments will make a material difference in addressing any special circumstances that may exist. 7. The city clerk shall prepare and cause to be inserted at least two weeks in the official city newspaper and in relevant industry publications an advertisement for bids for the making of said improvements under said approved plans and specifications. The advertisement shall appear not less than 10 days prior to the date and time bids will be received electronically by the project manager and accompanied by a bid bond payable to the city for five (5) percent of the amount of the bid. The electronic bids will only be available to view after the bids are closed and the city receives the passcode from the bidding host site. 8. The project manager, or designee, shall report the receipt of bids to the city council shortly after the opening date. The report shall include a tabulation of the bid results and a recommendation to the city council. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk City council meeting of February 3, 2025 (Item No. 7c) Page 6 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Resolution No. 25-021 Rescind Resolution No. 03-075 restricting parking on the east end of 35th Street near Beltline Boulevard Whereas, existing parking restrictions on 35th Street were approved in 2003 per Resolution No. 03-075 to address access needs for semi-truck deliveries to the adjacent business; and Whereas, these parking restrictions are no longer needed due to changes in adjacent land use; and Whereas, in 2025, the city will be reconstructing Raleigh Avenue and 35th Street. The project includes street reconstruction, utility improvements, curb replacement, street lighting, street rightsizing, and Whereas, the existing parking restrictions on 35th Street are not consistent with the 2025 Commercial Street Rehabilitation project recommendations; and Whereas, the City of St. Louis Park accepted the project report, established and ordered the 2025 Commercial Street Rehabilitation, project no. 4025-1050, Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota, that: 1. Resolution No. 03-075 is rescinded. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk Resolution No. 25-022 City council meeting of February 3, 2025 (Item No. 7c) Page 7 Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Authorizing parking restrictions on Raleigh Avenue and 35th Street Whereas, in 2025, the city will be reconstructing Raleigh Avenue and 35th Street. The project includes street reconstruction, utility improvements, curb replacement, street lighting, street rightsizing; and Whereas, street rightsizing will reduce the width of the majority of the streets from 40 feet to 33.5 feet; and Whereas, parking is to be restricted at various locations to provide safe and efficient travel of semi-truck and automobile travel; and Whereas, the City of St. Louis Park accepted the project report, established and ordered the 2025 Commercial Street Rehabilitation, project no. 4025-1050; and Whereas, Resolution No. 25-021 rescinded the existing parking restriction on 35th Street, Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota that the engineering director is authorized to: 1. Prohibit parking in the cul-de-sac at the west end of 35th Street. 2. Install parking prohibitions on the north side of 35th Street from cul-de-sac to Raleigh Avenue. 3. Install parking prohibitions on the north side of 35th Street from the intersection of Raleigh Avenue and 35th Street to include the westerly driveway of 5000 35th Street. 4. Install parking prohibitions on the east side of Raleigh Avenue from 36th Street to the intersection with 35th Street. 5. Installing parking prohibitions on the south side of 35th street from the intersection of Raleigh Avenue to the east side of the driveway at the west lot line of 3510 Beltline Boulevard. 6. Installing parking prohibitions on the south side of 35th street from the intersection of Beltline Boulevard to a point 125 feet west. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk M O N T E R E Y D R 36TH ST W 36TH ST W PARK CENTER BLVDPARK CENTER BLVDRALEIGH AVE SBELTLINE BLVDBELTLINEBLVDHIGHWAY100SMO N TE RE Y D R 35TH S T W PARK GLEN R D 35TH ST W 0 500 1,000250 Feet ´ Attachment #1 - 2025 Commercial Street Project Staff Recommendations Updated 12/10/2024 40 ft to 33.5 f t 40 ft to 33 .5 f t 40 ft to 33.5 ft40 f t Legend Sidewalk - recommended Street rehabilitation Water/Sanitary replacement and street rehabilitation Existing sidewalk Existing trail XX to XX Proposed street width changes City council meeting of February 3, 2025 (Item No. 7c) Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Page 8 Attachment #2 – Sidewalk Segment Matrix Segment #1 Raleigh Avenue / 35th Street – East / South Side (36th Street to 340 west of Beltline Boulevard) Data: Traffic volumes Varies from 1,439 to 1,968 vehicles/day Design: Right of way (ROW) width 60 feet Street width Existing 40 feet Proposed 33.5 feet *East/south curb line proposed to move towards centerline by 6.5 feet to preserve trees Boulevard width (distance from back of curb to ROW line) Existing 8 to 9 feet Proposed 14.5 to 15.5 feet Permanent easement required None Proposed boulevard width 0 to 5 feet Proposed concrete sidewalk width 5 feet Proposed sidewalk length 1,497 feet (78.5%) Existing sidewalk length 410 feet (21.5%) Snow removal responsibility Neighborhood sidewalk Impacts: Trees in boulevard 16 trees Trees removed 1 tree (2 inch diameter) Properties adjacent to proposed sidewalk 8 properties Landscaping impacted None Retaining walls impacted None Retaining walls proposed None Utility relocations Relocation of private utility handholes and poles. Relocation of city light poles and hydrants. Financial: Construction cost $150,258 *Updated from Jan. 6 study session Cost per liner foot of new sidewalk $100.37 / LF *Updated from Jan. 6 study session Staff recommendations: Build in 2025? Yes City council meeting of February 3, 2025 (Item No. 7c) Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Page 9 Segment #2 Raleigh Avenue / 35th Street – West / North Side (35th Street to 340 west of Beltline Boulevard) Data: Traffic volumes Varies from 1,439 to 1,968 vehicles/day Design: Right of way (ROW) width 60 feet Street width Existing 40 feet Proposed 33.5 feet *East/south curb line proposed to move towards centerline by 6.5 feet to preserve trees Boulevard width (distance from back of curb to ROW line) Existing 10 to 11 feet Proposed 10 to 11 feet Permanent easement required None Proposed boulevard width 0 to 5 feet Proposed concrete sidewalk width 5 feet Proposed sidewalk length 1,025 feet (51.9%) Existing sidewalk length 951 feet (48.1%) Snow removal responsibility Neighborhood sidewalk Impacts: Trees in boulevard (from ex. BOC to ROW line) 11 trees Trees removed 6 trees (diameters ranging from 5 to 15 inch) (60 total caliper inches) Properties adjacent to proposed sidewalk 5 properties Landscaping impacted Landscaping rocks to be removed and replaced after sidewalk construction. Retaining walls impacted None Retaining walls proposed None Private utility relocations Relocation of private utility handholes and poles. Relocation of city light poles and hydrants. Financial: Construction cost $105,076 *Updated from Jan. 6 study session Cost per liner foot of new sidewalk $102.51 / LF *Updated from Jan. 6 study session Staff recommendations: Build in 2025? Yes City council meeting of February 3, 2025 (Item No. 7c) Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Page 10 36 1/2STW36 1/2STW M O N T E R E Y D R M O N T E R E Y D R 36TH ST W36TH ST W 36TH ST W36TH ST W PARK CENTER BLVDPARK CENTER BLVD36TH ST W TO NB HWY100 S36TH ST W TO NB HWY100 SPARK CENTER BLVDPARK CENTER BLVDNB HWY100 S TO 36TH ST WNB HWY100 S TO 36TH ST WRALEIGH AVE SRALEIGH AVE SBELTLINE BLVDBELTLINE BLVDBELTLINEBLVDBELTLINEBLVDMO NT E R EY D R MO NT E R EY D R 35TH ST W 35TH ST W PARK GLEN RD PARK GLEN RD 35TH ST W 35TH ST W 0 500 1,000250 Feet ´ 2025 Commercial Street Rehabilitation Project Proposed Parking Restrictions Updated 12/20/2024 No parking Parking allowed City council meeting of February 3, 2025 (Item No. 7c) Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Page 11 Superior Moulding Corporation 5000 West 35th Street Minneapolis MN 55416 January 23, 2025 St Louis Park City Council via email to Councilperson Lynette Dumalag ldumalag@stlouisparkmn.gov re: Raleigh / West 35th St Commercial Street Rehab Project Dear Mayor and Council Persons Thank you for the opportunity to speak at the Jan 21 council meeting and for your consideration of this email follow up. My business has been located in SLP since 1986, and I have owned the building at the above address since 1994, about the time streets in the area were reconstructed to accommodate the water tower. My property is zoned Business Park, with affected properties to the west zoned Industrial Park. Conforming use of these properties includes regular semi trailer truck traffic. These streets definitely need reconstruction and addition of a sidewalk. Addition of a single sidewalk on the west / north sides would provide sufficient and safe pedestrian access far into the future. The addition of the second sidewalk on the east / south side is expensive, unnecessary, subtractive to property value, and introduces safety concerns to the existing and conforming use of our properties. Narrowing of streets in residential areas may be right-sizing, but the current 40 foot street width is an important asset to our commercial properties. It allows quick and safe entry and exit to the wide variety of successful businesses operating on 35th Street and Raleigh Avenue. Maintaining the current street width would reduce the need for tree removal, simplify street parking regulation, moderate the project construction cost, and provide smooth and safe access to the area for coming decades. Thank you for your consideration of my position on this project. Kind regards City council meeting of February 3, 2025 (Item No. 7c) Title: Resolutions establishing the 2025 Commercial Street Rehabilitation project (4025-1050) – Ward 2 Page 12 Meeting: City council Meeting date: February 3, 2025 Action agenda item: 7d Executive summary Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Recommended action: • Motion to adopt a resolution approving the final plans and specifications and authorizing ad for bid for Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) • Motion to adopt a resolution rescinding three resolutions and authorizing parking restrictions on Louisiana Avenue Policy consideration: Does the city council wish to pursue the construction of the Cedar Lake Road and Louisiana Avenue Improvement project Phase 2? Summary: On Feb. 6, 2023, the city council approved the preliminary layout for the Cedar Lake Road and Louisiana Avenue Improvement project. This project includes the following phases: Phase 1: Cedar Lake Road (TH169 to Rhode Island Avenue) – project no. 4023-1100 • Construction completed in 2024 Phase 2: Cedar Lake Road (Rhode Island Avenue to Kentucky Avenue) and Louisiana Avenue (Wayzata Boulevard to BNSF railroad) – project no. 4024-1100 • Construction in 2025 and 2026 Since Feb. 2024, staff have been working with consulting firm Kimley-Horn on further refining the design for Phase 2 of this project, and the final plans and specifications are complete. A summary of the changes to the project discussed in this report: • Land acquisition • Parking restrictions • Tree removal • Open House #5 • Updated project cost The approved preliminary layout for this project removed parking in the corridor. To formalize these parking restrictions, a "no parking" resolution is attached. Financial or budget considerations: This project is included in the city's capital improvement plan (CIP). The total project cost for the construction of Cedar Lake Road and Louisiana Avenue Phase 1 and 2 is estimated at $29,005,941.43. Phase 2 costs in 2025 and 2026 have increased since the budget was adopted and those changes are discussed in this report. Strategic priority consideration: St. Louis Park is committed to providing a variety of options for people to make their way around the city comfortably, safely and reliably. Supporting documents: Discussion Resolutions Resolutions to be rescinded: 2983, 7295, 92-058 Project staging map 2024-2026 Prepared by: Aaron Wiesen, engineering project manager Reviewed by: Debra Heiser, engineering director; Amelia Cruver, finance director Approved by: Kim Keller, city manager City council meeting of February 3, 2025 (Item No. 7d) Page 2 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Discussion Background: The Cedar Lake Road and Louisiana Avenue Improvement project has been in front of the council numerous times. A summary: • On Feb. 6, 2023, the city council approved the preliminary layout and authorized development of final plans for the Cedar Lake Road and Louisiana Avenue Improvement project. This project includes the following phases: Phase 1: Cedar Lake Road (TH169 to Rhode Island Avenue) – project no. 4023-1100 • Construction completed in 2024 Phase 2: Cedar Lake Road (Rhode Island Avenue to Kentucky Avenue) and Louisiana Avenue (Wayzata Boulevard to BNSF railroad) – project no. 4024-1100 • Construction in 2025 and 2026 • An overall project update was provided to the city council at the Aug. 28, 2023 study session, including updated scope, cost and funding. • On Oct. 2, 2023, the city council approved a resolution to commence eminent domain for the easements needed to construct Cedar Lake Road (Phase 1) in 2024. • An overall project update, for both phases, was provided to the city council at the Jan. 22, 2024 study session. • On Feb. 20, 2024, the city council approved the final plans and specifications for the Cedar Lake Road project (Phase 1) and authorization of parking restrictions on Cedar Lake Road. • On May 20, 2024, the city council approved the bid for the construction of Cedar Lake Road (Phase 1). • To meet the requirement of the state grant funding, the city committed city financing to complete both Phase 1 and 2 of the project on July 8, 2024. The state grant agreements were approved by council on Aug. 19, 2024. • The resolution to commence eminent domain for the easements needed to construct Cedar Lake Road and Louisiana Avenue (Phase 2) in 2025 and 2026 was approved by council on Sept. 16, 2024. • The city council approved the application for an Environmental Response Fund (ERF) grant from Hennepin County to help pay for contaminated soil in Phase 2 on Oct. 7, 2024. • Phase 2 land acquisitions at the intersection of Cedar Lake Road and Louisiana Ave were approved by council on Oct. 7, Nov. 4 and Dec. 16, 2024. City council meeting of February 3, 2025 (Item No. 7d) Page 3 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 The final plans and specifications for the construction of Cedar Lake Road and Louisiana Avenue Phase 2 are complete. Staff recommend that the council approve them for bidding. Present considerations: A few changes have occurred since the last project update in February 2024. The following is a summary of the changes to the project discussed in this report: • Land acquisition • Parking restrictions • Tree removal • Open house #5 • Updated project cost Land acquisition: Since April 2024, staff have been working with the city attorney and consultants to secure the temporary and permanent easements needed to construct Phase 2 of this project. In all, Phase 2 of the project requires easements from 51 properties and the total acquisition of one parcel. Currently, the project team has settled with all but five (5) of the property owners that we require easements from. In addition, the acquisition of the West End tobacco shop was completed on Jan. 17, 2025. Because these easements are needed to build the project as approved, we will be acquiring the easements from the remaining five parcels through condemnation. Even though we are proceeding with condemnation, the project team will continue to work with property owners to come to an agreement on compensation. If we are able to come up with an agreement and obtain the mortgage holder's consent prior to the hearing, the property will be removed from the condemnation process. Tree removal: To avoid conflicts with nesting birds, bats and bees to meet our federal grant obligations, the trees identified for removal as part of Phase 2 of the project must be removed prior to March 31, 2025, or after Oct. 31, 2025. Staff are soliciting bids for this work separately from the construction contract so it can be completed by March 31, 2025. The estimate for this tree removal work is $27,000. Additional information regarding the tree removal schedule will be shared with the public prior to work commencing. Open house #5: Residents and business owners were invited to the fifth open house to review the final plans for the Phase 2 project. This open house was held in person on Dec. 5, 2024. The presentation slides, layouts and exhibits of the open house are available on the project website for anyone who was unable to attend. Approximately 28 people attended the open house. Information on the council-approved design was presented at the open house. The construction schedule, phasing and detour plans were also shared. City and consultant staff were on site to answer questions about the project and what to expect during construction. Parking: To construct the project in accordance with the approved layout, the on-street parking, which is currently on both sides of Louisiana Avenue, will need to be removed. The removal of parking has been communicated to community members throughout the public process. To formalize these parking restrictions, a "no parking" resolution is attached. City council meeting of February 3, 2025 (Item No. 7d) Page 4 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Louisiana Avenue currently has three resolutions that regulate parking within the project limits. The resolution included in this report will rescind the current resolutions and pass a new resolution that will prohibit parking on Louisiana Avenue from Wayzata Boulevard to the BNSF railroad. Approval of this resolution will formalize parking restrictions along the corridor. Updated project cost: In the Feb. 20, 2024 city council report, the total cost for the 2024-2026 Cedar Lake Road and Louisiana Avenue project was estimated at $28,252,970. Since that report, staff have been working with Kimley-Horn on the final design for Phase 2 and new information has added work to the project resulting in an increase in the project cost. The updated estimated project cost is $29,005,941.43, which is 2.67% ($752,971.45) higher than the cost in the CIP. A summary of the justification for this construction cost increase: • During the environmental review, it was discovered that there are contaminated materials that will need to be removed, hauled offsite and disposed of in a landfill. The estimated cost for the removal of contaminated material is $600,000. o To pay for this additional cost, staff applied for an Environmental Response Fund (ERF) Grant of $600,000 from Hennepin County in Oct. 2024. The ERF program provides funding for a variety of activities at contaminated sites where the added environmental costs hinder site improvements or redevelopments. The city will know if we are successful in getting the grant in April 2025. • According to new rules from PROWAG (Public Right of Way Accessibility Guidelines), crosswalks at multilane roundabouts must have additional treatments that alert motorists to the presence of pedestrians. To comply with the new rules and ensure a safe crossing for pedestrians and bicyclists, the project now includes user-actuated rectangular rapid flashing beacons at each of the crosswalk locations at the Cedar Lake Road and Louisiana Avenue roundabout. The additional cost for this work is $200,000. • Additional sanitary sewer main replacement has been added to the project, which is estimated to cost $198,000. This was added at the request of utility staff after inspecting the condition and determining additional pipe and manhole replacement needs. The work is necessary to ensure the underground utility infrastructure will continue to serve our customers now and in the future. The engineering staff are working with finance staff to adjust the funding plan for this project and will bring back a budget amendment when bids are accepted to fully fund the additional costs identified in this report. Financial or budget considerations: The CIP identified a combination of federal (regional solicitation and congressionally directed spending), state, MSA, MSA bonds and utility funds to cover the overall project costs. Since the last update to council, staff have been informed by MnDOT that we are not able to use federal or state funds to pay for certain construction costs identified in the project. This has resulted in and additional $124,000 in local funds being needed for this project. A summary of the items that require local funding are: City council meeting of February 3, 2025 (Item No. 7d) Page 5 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 • Tree planting – federal aid only pays for two new trees for each one tree removed. Our city tree replacement is based on caliper inches, so we are planting more trees than the 2:1 ratio. The additional tree planting cost is $51,000. • The council-approved bike facility for Louisiana Avenue is an alternative bike route on Hampshire Avenue, Pennsylvania Avenue, 22nd Street and Wayzata Boulevard. We are not able to use MSA funds to pay for work on streets that are not on the MSA system. Due to this, the cost of these bike facilities, $73,000, would need to be paid for by local funds. The following table includes a summary of the updated cost and proposed funding for all phases of this project. As described above, there is an increase in the estimated construction cost for this project; however, a portion of this increase is offset by the engineering/ administration and land acquisition costs being lower than estimated in the CIP. MSA bonds and local funds are recommended to be used to cover these additional costs. The actual construction cost will depend on the bids received and the funding will be updated to match. Cedar Lake Road/ Louisiana Ave Improvement project overall project cost (2024-2026) Project Nos: 4023-1100 and 4024-1100 Description Overall CIP 4023-1100 Phase 1 (Actual) 4024-1100 Phase 2 (Estimated) Overall Phase 1 & 2 Construction $ 19,998,470.00 $ 7,717,690.42 $ 13,422,332.00 $ 21,140,022.42 Engineering and administration $ 5,734,500.00 $ 2,197,987.72 $ 3,421,570.29 $ 5,619,558.01 Land acquisition $ 2,520,000.00 $ 432,467.00 $ 1,813,894.00 $ 2,246,361.00 Total: $ 28,252,970.00 $ 10,348,145.14 $ 18,657,796.29 $ 29,005,941.43 Funding sources Federal aid $ 7,000,000.00 $ 2,264,000.00 $ 4,736,000.00 $7,000,000.00 Congressionally directed spending $ 2,000,000.00 $ 2,000,000.00 $ 0.00 $ 2,000,000.00 State appropriation $ 5,000,000.00 $ 1,558,292.65 $ 3,441,707.35 $ 5,000,000.00 Municipal state aid $ 6,537,823.00 $ 2,406,242.27 $ 4,131,581.00 $ 6,537,823.27 Municipal state aid bonds $ 3,120,207.00 $ 0.00 $ 3,551,210.33 $ 3,531,210.33 Local funds $ 0.00 $ 0.00 $ 124,000.00 $ 144,000.00 Sanitary sewer $ 50,000.00 $ 21,441.60 $ 226,526.00 $ 247,967.60 Watermain $ 3,403,470.00 $ 1,292,691.18 $ 2,110,778.61 $ 3,403,469.79 Stormwater $ 1,141,470.00 $ 805,477.44 $ 335,993.00 $ 1,141,470.44 Total: $ 28,252,970.00 $ 10,348,145.14 $ 18,657,796.29 $ 29,005,941.43 Budget amendment resolution: The overall cost for these projects is 2.67% ($752,971.45) higher than the cost in the CIP. In addition, there are changes in how the different funding is being allocated for each project, and there is a need to use local funding, which was not identified in the CIP. Due to these changes, staff will be bringing to the council a budget amendment resolution in the coming months. City council meeting of February 3, 2025 (Item No. 7d) Page 6 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Bids for phase 2 will be opened in March; once we have the contractors' bid, staff will refine the overall funding package for the two projects and bring forward a budget amendment resolution for council approval as a part of the bid award council action. Next steps: The proposed schedule for Phase 2 of this project is as follows: Council approves final plans and no parking resolution Feb. 3, 2025 Condemnation hearing and easements finalized Feb. 10, 2025 Final plans submitted to MnDOT for review February 2025 Tree removal February/March 2025 Bid opening March 2025 Council awards bid April 2025 Private utility relocation April - May 2025 Construction begins on Louisiana Avenue May 2025 Louisiana Avenue construction complete and open to the public November 2025 Construction begins on Cedar Lake Road and roundabout at Cedar Lake Road/Louisiana Avenue May 2026 Project substantially complete and open to the public November 2026 City council meeting of February 3, 2025 (Item No. 7d) Page 7 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Resolution No. 25-___ Accepting the project report, establishing Improvement Project No. 4024-1100, approving plans and specifications and authorizing advertisement for bids for improvement Project No. 4024-1100 Whereas, the city council of the City of St. Louis Park has received a report from the project engineer related to the 2025-2026 Cedar Lake Road and Louisiana Avenue Improvement project on February 3, 2025; and Now therefore be it resolved by the city council of the City of St. Louis Park, Minnesota, that: 1. The project report regarding Project No. 4024-1100 is hereby accepted. 2. Such improvements as proposed are necessary, cost-effective and feasible, as detailed in the project report. 3. 2025-2026 Cedar Lake Road and Louisiana Avenue Improvement, designated as Project No. 4024-1100, between Rhode Island Avenue and Kentucky Avenue and Wayzata Boulevard and BNSF railroad, is hereby established and ordered. 4. The plans and specifications for the making of these improvements, as prepared under the direction of the engineering director, or designee, are approved. 5. The city clerk shall prepare and cause to be inserted at least two weeks in the official city newspaper and in relevant industry publications an advertisement for bids for the making of said improvements under said approved plans and specifications. The advertisement shall appear not less than 10 days prior to the date and time bids will be received electronically by the project manager and accompanied by a bid bond payable to the city for five (5) percent of the amount of the bid. The electronic bids will only be available to view after the bids are closed and the city receives the passcode from the bidding host site. 6. The project manager, or designee, shall report the receipt of bids to the city council shortly after the opening date. The report shall include a tabulation of the bid results and a recommendation to the city council. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed, mayor Attest: Melissa Kennedy, city clerk City council meeting of February 3, 2025 (Item No. 7d) Page 8 Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) – Ward 4 Resolution No. 25-____ Authorizing parking restrictions on the east and west sides of Louisiana Avenue from Wayzata Boulevard to the bridge over the railroad tracks Whereas, the City of St. Louis Park established various parking restrictions on Louisiana Avenue from Wayzata Boulevard to the bridge over the railroad tracks in Resolutions No. 2983, 7295, 92-058; and Whereas, these resolutions were approved over a period of years to prohibit parking along certain segments of Louisiana Avenue; and Whereas, there are locations along Louisiana Avenue where parking is allowed; and Whereas, the City of St. Louis Park is reconstructing Louisiana Avenue and Cedar Lake Road in 2025 and 2026; and Whereas, the geometric design for Louisiana Avenue from Wayzata Boulevard to the bridge over the railroad tracks does not provide the required space for on-street parking on either side of the street; and Whereas, the City of St. Louis Park staff recommended rescinding Resolutions No. 2983, 7295, 92-058; and Whereas, the intent of rescinding these Resolutions is to remove the existing parking restrictions on both sides of Louisiana Avenue and to establish a new resolution to cover both sides of Louisiana Avenue from Wayzata Boulevard to the bridge over the railroad tracks as part of the reconstruction; and Now therefore be it resolved, by the city council of the City of St. Louis Park, Minnesota, that the following resolutions be rescinded: • Resolution No. 2983 • Resolution No. 7295 • Resolution No. 92-058 It is further resolved, by the city council of the City of St. Louis Park, Minnesota, that the engineering director is authorized to: • Install parking restrictions on the east and west sides of Louisiana Avenue from Wayzata Boulevard to the bridge over the railroad tracks. Reviewed for administration: Adopted by the city council February 3, 2025: Kim Keller, city manager Nadia Mohamed , mayor Attest: Melissa Kennedy, city clerk JANUARY :0, 1966 70 RESCLUTICN NO ,• _2_-9_8_3_ RESCLUTION AUTHCRIZING PLACElv,ENT CF TRAFFIC CONTRCL SIGNS REGULATING PARKING WHEREAS, the City of St, Louis Park has caused a traffic analysis to be made on the_ streets of the City with respect to parking time limits, and WHEREAS, the results as analyzed by the Traffic Department of the City indicate that the following limitations on parking arc warranted on the hereinafter dcocribed streets, upon the basis of their physical characteristics, driver be- havior, and traffic conditions, and WHEREAS, Crdinance No. 702, adopted June 8, 1959, by the City Council, (Sections 3:115, 3:116 and 3:117 of the St. Louis Park Crdinance Code) provides for installation of traffic control signs, signals and devices when and as required by resolution of the City Council, there£ ore BE IT RESCLVED by the City Council of the City of St. Louis Park that the City Engineer is hereby authorized and directed to install tra £fie control devices of approved type setting time limits on parking on the following portions of street, during of the day as follows: No parking any time on east side of Edgewood Avenue from Cedar Lake Road to l, 400 feet south, No parking any time on both sides of Louisiana A.venue from Cedar Lake Road to 300 feet north. No parking Sunday from 6:00 a. m. to 1 :00 p. m. on west side of Quebec Avenue from Cedar Lake Road to 24th Street. Two (2).hour parking on east side of Yosemite Avenue from Excelsior Boulevard to 200 feet south . .... --11NG-PA-R-i'a-NG" 011 east' side·-of·XenwoodAvenue from 36th Street 157 feet south, Adopted by the City Council Janu City Clerk / R cvicwcd for aclrninistration: f -r ,:,•. Iv , (/: ,: :(., •, ( ., !/ - .) Approved as to form and legality: .. , , '.'(' ·/,· -1,,._" /:_,,,,,� ,, ' ,, ,/ City council meeting of February 3, 2025 (Item No. 7d) Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) - Ward 4 Page 9 CEDAR LAKE R D LOUISIANA AVE S22NDST W 18THST W 16THST W CEDARMANOR LAKE HANNAN LAKE VICTORIA LAKE COBBLECREST LAKE WESTWOODLAKE WESTLING POND Northside Park Lamplighter Park Cedar Knoll Park Westwood Hills Nature Center 29TH ST W MINNETONKA BLVDHIGHWAY 16914TH ST W WAYZATABLVD 28TH ST WTEXASAVESINTERSTATE 394 27TH ST W 22ND ST W CLUB RD 24TH ST W PENNSYLVANIA AVE SVIRGINIA CIR N RHODE ISLAND AVE SFLAG AVE S25TH ST W ZINRAN AVE SFRANKLINAVEW VICTORIA W AYUTAHDR VIRGINIAAVESKENTUCKY AVESWESTWOOD HILLS DRBURD PLWYOMINGAVESGETTY S BURGAVESQ U EB E C A V E S OREGON AVE S18TH ST W 16TH ST W13THLNW 2 6 T H S T WHILLSBOROAVESFAIRWAYLN BOONEAVES JORDANAVESINDEPENDENCEAVESW ESTMORELANDLN O R EGONCT13 1/2 ST W QUEBECDR AQUILAAVESMARYLAND AVE SNEVADA AVE SDECATUR AVE SVIRGINIA CIR S 22ND LN W Y UKONAVES23RD ST W T E X A TONKAAVEUTAH AVESCAVELL A VESSTANLEN RD XYLONAVESEB I394 TOLOUISIANAAVE S WESTWOODHILLSCURV0 0.5 10.25 Miles Cedar Lake Road and Louisiana Avenue Improvements Legend 2024 construction 2025 construction 2026 construction Municipal boundary RHODEISLAND A VESSUMTERAVESCity council meeting of February 3, 2025 (Item No. 7d) Title: Resolutions establishing Cedar Lake Road and Louisiana Avenue Improvement project Phase 2 (4024-1100) - Ward 4 Page 10 Meeting: Special study session Meeting date: February 3, 2025 Discussion item: 1 Executive summary Title: Boards and commissions protocol setting meeting Recommended action: There is no action being requested; this item is for discussion purposes. Policy consideration: None Summary: At the conclusion of the boards and commissions redesign process, the city council asked to take on a more significant role directing the work of all boards and commissions. In response, staff organized conversations between the city council and representatives of advisory and statutory boards and commissions. The goal of these conversations was for the council to hear directly from the boards and commissions and use the insights gained to set future priorities. The next step was to establish protocols around how the boards and commissions would operate for 2025. To achieve this, staff formed a workgroup including city staff and three city council members to discuss a variety of issues and provide recommendations for the council to consider at the study session on Feb. 3, 2025. During this study session discussion, the council will discuss the outcomes of these workgroup meetings with a goal of reaching agreement for the boards and commissions. Financial or budget considerations: None Strategic priority consideration: St. Louis Park is committed to creating opportunities to build social capital through community engagement. Supporting documents: Discussion City Council Study Session Request form (revised) Advisory communication to council form Prepared by: Pat Coleman, community engagement coordinator Reviewed by: Cheyenne Brodeen, administrative services director Approved by: Kim Keller, city manager Special study session meeting of February 3, 2025 (Item No. 1) Page 2 Title: Boards and commissions protocol setting meeting Discussion Background: During a May 20, 2024 study session, council members discussed how best to provide policy direction to both statutory and advisory boards and commissions. This discussion stemmed from previous council directives where members expressed a desire to play a more significant role with these bodies. A key part of the conversation focused on the nature and frequency of interactions between the council and these bodies. As the discussion evolved from past practices to exploring new opportunities for engagement, the following points emerged: • The council agreed to hold an annual meeting with boards and commissions to discuss priorities. • The council supported one-on-one meetings with commissions to discuss their systems approach and work plans. Factors such as the COVID-19 pandemic and the boards and commissions redesign project influenced changes in past interactions. With the redesign project now complete, board and commission members have asked for more engagement with the council. To further explore opportunities for increased interaction, staff assembled a workgroup that included board and commission staff liaisons Emily Ziring (environment and sustainability commission), Jacque Smith (community technology advisory commission), Marney Olson, housing authority board), and Council Members Tim Brausen, Sue Budd and Margaret Rog. To effectively prepare for these discussions, staff compiled materials that provided guidance on key issues to address. These materials included meeting minutes from the 2024 boards and commissions check-in meetings, documents and findings from the redesign project that highlighted themes and concerns raised by board and commission members, and past and current work plans. This workgroup convened three times in January 2025, totaling 4.5 hours of discussions. The workgroup covered a range of topics related to boards and commissions and explored ways to enhance engagement with the council and set common expectations. The purpose of these discussions was to prepare for the study session on Feb. 3, 2025. These thorough discussions provided valuable information for setting standard expectations for 2025 and beyond. While today’s meeting will focus on actions for 2025, these topics will be revisited continuously to ensure the effectiveness of the boards and commissions program is monitored and that every board and commission is able to provide a valuable service to the community. Present considerations: Today’s study session is an opportunity for the full council to discuss the outcomes from the workgroup sessions. The discussion will center on the following topics: expectations of boards and commissions, work plans, meetings, communication forms, and information resources for council. Each of those sections will be broken down into the current recommendation that came from the workgroup, how it will be implemented in 2025, a look at 2026 plans, and any open issues that exist around the topic that require further conversation. Special study session meeting of February 3, 2025 (Item No. 1) Page 3 Title: Boards and commissions protocol setting meeting Topic: Role and expectations • Recommendations o Boards and commissions expectations:  The boards and commissions provide a platform for over 50 community members to serve as the “ears” of the community, offering authentic and meaningful engagement on issues that matter to them. It is encouraging to see both the volume and quality of interested participants.  The group acts as a sounding board for the city council, offering advice on areas of concern and providing feedback on policy objectives and proposals in a systematic manner, ideally before they reach the council. This feedback process could become a regular part of the council’s agenda.  There are standard expectations for members to attend scheduled meetings, assist in decision making on behalf of the public, and keep city council members informed on work plan items outside of city council requests.  Staff to publish agendas, minutes, coordinate meeting dates, etc. o What does advising city council look like for boards and commissions?  Boards and commissions assist/advise city council in the policy decision-making process on behalf of the public.  Additionally, boards and commissions advise city council on work plan items outside of city council-initiated work plan requests. • Open issues o How does council ensure that boards and commissions are involved in the policy decision-making process? o How does council envision this in practice so that boards and commissions input is reflected in council decision-making? (Consider the IAP2 Public Engagement Spectrum.) Topic: Work plans • Recommendations o Treat work plans as living documents that can be amended at any time via new communication process (see “Communication forms” section) o Work plans should be no more than six items, with most items initiated by council • 2025 implementation plan o Review and approve all 2025 work plans in February o Allow work plans to be amended at any time via new communication process o Work plans remain in effect until each board or commission presents to council in 2026 (one commission presenting approximately every two months) • 2026 implementation plan o Finalized work plans will be due the month after a board or commission meets with council (see “Meetings” section) and will be included in the packet for council approval o Allow work plans to be amended at any time via new communication process o Work plans to remain in effect until board or commission returns to council in 2027 • Open issues o How many commission-led events can be included in a work plan? Special study session meeting of February 3, 2025 (Item No. 1) Page 4 Title: Boards and commissions protocol setting meeting o If an advisory commission work plan is comprised entirely of commission-initiated and/or staff-initiated items—and council does not request any additional items of the board or commission over the course of the year—how should council respond? Topic: Meetings • Recommendations o Because the city’s strategic priorities do not pair neatly with the codified purpose of every board and commission, rather than holding scheduled check-in meetings with each board or commission during a scheduled system, each commission will be assigned a month in which they will have a 30-60 minute opportunity to meet with council on a yearly basis. o Staff will consider re-introducing the annual board and commission recognition meeting based on interest level of current boards and commission members. • 2025 implementation plan o The following schedule will go into effect this year: Month (2025) Commission April CTAC May ESC June PRAC July FCS August PAC September HRC October Housing Authority November PL/BOZA o The expectations of these meeting are:  Chair/vice chair and liaison at the table with city council (rest of commission invited to attend)  Commission/work plan overview provided by chair/vice chair  Council feedback, including work plan modifications and additions o Survey current boards and commission members to assess the interest of an annual meeting • 2026 implementation plan o Revisit meeting schedule and adjust as needed • Open issues o Are there any other expectations for boards and commissions during the month of their meeting? o Are annual reports also required, and if so, what is the appropriate timeline for their completion? Topic: Communication forms • Recommendation o Create additional channels of communication that allow for increased interaction between boards and commission members and city council and remove the perception that staff are serving as a firewall between council and boards and commissions. • 2025 implementation Special study session meeting of February 3, 2025 (Item No. 1) Page 5 Title: Boards and commissions protocol setting meeting o Pilot use of the following forms  City Council Study Session Request form revision: a checkbox for each of the advisory boards will be added to the existing form that allows council members to indicate up to two boards and commissions they would like to review their proposal, should the topic be approved by council for a further study session.  Advisory communication to council: boards and commissions will have the opportunity to submit a form to council (via their liaison) that allows them to communicate with council regarding current initiatives, potential work plan additions, and provide updates on concluded work plan items.  Work plan template: if council votes to add an additional item to a board and commission’s approved work plan (with or without first receiving an advisory communication), they can request that staff create the additional item using the current work plan template. • 2026 implementation o Evaluate the effectiveness of the forms and implement necessary revisions. • Open issues o Should the council commit to discussing all advisory communication request forms during the next scheduled study session? o Once a board/commission has reviewed the approved proposal, what are the next steps? Topic: Information resources for council • Recommendation o Provide a comprehensive collection of information for city council to facilitate ongoing communication with boards and commissions outside of scheduled meetings. • 2025 implementation o Create an internal directory that includes the following:  Contact information for the chair and vice chair.  Schedule of meetings in one calendar (editable by liaisons to allow for meeting cancellations and date changes.) o 2026 implementation  Evaluate the effectiveness of the resources and implement necessary revisions. o Open issues  Can each council member commit to attending two commission meetings each year?  What would be the best way to communicate upcoming board and commission- led events? (Ideas include adding them to the internal directory, publishing them under “Communications and announcements” in council packets, and including them in Before the Weekend emails.) Next steps: Following the council’s direction from this discussion, staff will use this information to begin implementing changes. Boards and commissions have developed their initial work plans and council should receive them as a consent item in February. Program management staff and staff liaisons will filter the information to ensure everyone involved is well informed about what to expect in 2025. City Council Study Session Topic Proposal Date: Prepared by: Proposed agenda topic: Brief Description of topic (no more than 200 words): How does this topic align with the council strategic priorities? If not, why should the council consider the topic: If approved, would an advisory board/commission review this proposal? If so, select up to 2 below: ☐ESC ☐PRAC ☐PAC ☐HRC ☐CTAC ☐NONE ** Please email completed forms to Kim Keller and Melissa Kennedy. Special study session meeting of February 3, 2025 (Item No. 1) Title: Boards and commissions protocol setting meeting Page 6 1 Advisory communication to council Please use this form to submit a board or commission-related topic for city council consideration. Note that use of this advisory communication to council requires a majority vote of a city board or commission prior to submission. Decisions on whether to take up an issue will be made by council. Use the sections below as a guide and omit sections that may be extraneous. Date: January 30, 2025 To: City council From: Commission name Subject: Strategic priority (if applicable): Approved work plan item? ☐Yes ☐No Council request: ☐ Review and comment or reply ☐Review and decide (e.g., new work plan item) ☐Informational only – no response needed Action requested: What is the commission asking Council to do? For non-work plan items, no action will be taken unless Council chooses to provide direction or otherwise discuss at a future meeting. If requesting a new work plan item, make explicit. Background: Explain the exact circumstances of the situation and provide general information about the topic/issue. Assessment: Explanation of the Commission’s stance on a particular topic/issue, how it supports existing strategic priorities, etc. Will the action require cross collaboration with another board or commission? If action is requested, this should provide the justification for that action. Recommendation: Recommendations should be included for “review and decide” initiatives. Include clear explanation of recommendation(s). This section can include a bulleted list of each individual recommendation, etc. Staff will provide their recommendations on the staff report. Special study session meeting of February 3, 2025 (Item No. 1) Title: Boards and commissions protocol setting meeting Page 7 Meeting: Special study session Meeting date: February 3, 2025 Written report: 2 Executive summary Title: Community Development Block Grant 2025 Recommended action: No action required at this time. Policy consideration: Does the city council concur with the recommendations made for the allocation of $169,216.21 in 2025 Community Development Block Grant Funds? Summary: Each year the city receives an allocation of Community Development Block Grant (CDBG) funds from the U.S. Housing and Urban Development (HUD) and the city must decide how to use the funds within program limitations. CDBG funds are distributed from HUD through Hennepin County. The city must submit its proposed uses of the allocation to Hennepin County. Prior to submittal, the city must hold a public hearing which is scheduled for Feb. 18, 2025. The city has not yet received the 2025 direct allocation amount. For planning purposes Hennepin County is using the 2024 allocation amount of $169,216.21 for 2025. Beginning in 2018, Hennepin County began setting aside 15% of the overall annual CDBG budget for public service activities to be awarded through a combined, competitive request for proposals (RFP) covering all the cities in the county program. Public service activities that serve St. Louis Park may apply to the Hennepin County RFP. Hennepin County has also indicated they will be making changes to the direct allocation process for all CDBG funds in 2026. Staff’s recommendation for this year’s proposed use of CDBG funds reflects the city’s priorities to preserve existing affordable housing and increase affordable home ownership opportunities by allocating all CDBG funds to the low-income deferred rehab loan. Given the current political climate, should the CDBG funding not materialize, staff could seek other funding sources to offset the loss of funding. Financial or budget considerations: CDBG funds allow cities discretion, within HUD guidelines, to fund projects that meet the national low-income objectives and the needs of the cities. The federal budget has not been finalized, so the Hennepin County estimate of $169,216.21 may change. The 2025 CDBG year runs from July 1, 2025 through June 30, 2026. Strategic priority consideration: St. Louis Park is committed to providing a broad range of housing and neighborhood oriented development. Supporting documents: Discussion Prepared by: Marney Olson, housing supervisor Reviewed by: Karen Barton, community development director Approved by: Kim Keller, city manager Study session meeting of February 3, 2025 (Item No. 2) Page 2 Title: Community Development Block Grant 2025 Discussion Background: The national objectives of the federal Community Development Block Grant (CDBG) program are: • to benefit low- and moderate-income persons, • prevention or elimination of slum or blight, and/or • to meet a particular urgent community development need. The city council has historically focused CDBG funds on improvements to the housing stock for low-income households or on affordable homeownership. The CDBG program allows for up to 15% of allocated funds to be used to fund public services. Beginning in 2018, Hennepin County set aside the public service funds to be awarded through a combined, competitive RFP . In the past, the city has also funded rehabilitation and improvements at affordable housing properties in St. Louis Park. Federal regulations and other regulatory requirements related to the use of federal funding for multifamily properties, along with St. Louis Park’s limited CDBG award, have complicated and increased the costs to fund these types of projects. This combined with the increased demand for the low-income deferred rehab loan program resulted in staff recommending and the city council allocating the city’s entire CDBG award to the low-income deferred rehab program the last two CDBG funding years. Present considerations: The 2025 estimated CDBG allocation is $169,216.21. Staff recommend all of the FY2025 CDBG funds be allocated to the low-income deferred rehab loan administered by Hennepin County. The low-income deferred loan program serves St. Louis Park homeowners with annual incomes at or below 80% area median income. The rehab focuses on improvements to address code deficiencies, deferred maintenance and provide long-term maintenance-free housing. The maximum loan amount is $30,000, has 0% interest and is deferred until the sale of the home or forgiven after 15 years. There continues to be a long waiting list for this program. To address the backlog, the city budgeted an additional $300,000 in city (non CDBG) funds for this program in 2024. With future changes to the CDBG program Hennepin County has notified the city they cannot accept city funds for this program. Staff will be working to identify other loan alternatives and partners to continue to address this need in St. Louis Park. Future considerations: Hennepin County has notified direct allocation cities, including St. Louis Park, that to meet ongoing requirements of the Urban Hennepin County Community Development Block Grant Program (Urban County CDGG Program), Hennepin County is moving toward one consolidated funding pool guided by the Consolidated Plan prior to program year 2026 (beginning July 1, 2026). 2025 is the last year that cities in Hennepin County, including St. Louis Park will receive direct allocation funding. Additional information will be provided and discussed during the Housing and Neighborhood Development systems discussion in 2025 relating to the changes to the CDBG program beginning with the 2026 program year. Next steps: The 2025 CDBG public hearing is scheduled for Feb. 18, 2025. Meeting: Special study session Meeting date: February 3, 2025 Written report: 3 Executive summary Title: Proposed amendments to city code chapters 8 and 18 related to tobacco licensing and definitions of drug paraphernalia Recommended action: None at this time, unless council requests further discussion. Policy consideration: Does council wish to proceed with amendments to city code section 18- 94 related to definitions of drug paraphernalia and chapter 8, subdivision X. related to tobacco licensing? Summary: In 2023, the state of MN legalized the use of cannabis products by adults aged 21 and older. Possession and home growing of cannabis is now legal with certain limitations. Currently, section 18-94 of the city code references marijuana as a controlled substance, which no longer aligns with recent changes to state statutes defining drug paraphernalia. The city attorney has advised amending city ordinance referencing drug paraphernalia to no longer include items related to marijuana. The introduction of legalized cannabis is likely to generate public demand for cannabis paraphernalia. As these items are no longer by definition “drug paraphernalia”, the city is expecting retail businesses to have an increased interest in offering them for sale. Staff is recommending allowing businesses with an active tobacco license to sell cannabis paraphernalia and limit retail access similar to tobacco, helping ensure the health and safety of the community. In addition, licensed cannabis retailers are allowed to sell cannabis related devices under state law. Financial or budget considerations: Not applicable. Strategic priority consideration: Not applicable. Supporting documents: Discussion Prepared by: Michael Pivec, property maintenance & licensing manager Reviewed by: Brian Hoffman, building and energy director Approved by: Kim Keller, city manager Special study session meeting of February 3, 2025 (Item No. 3) Page 2 Title: Proposed amendments to city code chapters 8 and 18 related to tobacco licensing and definitions of drug paraphernalia Discussion Background: On July 1, 2022, a new Minnesota law allowed people 21 and over to buy and consume pre-packaged food and beverages products with no more than five (5) milligrams of hemp- derived THC per serving and no more than 50 milligrams per package. In 2023, legalization expanded to include the use of other cannabis products by adults aged 21 and older. Possession and home growing of cannabis is now legal with certain limitations. While some Tribal Nations have already opened retail stores for cannabis sales on tribal land, the Minnesota Office of Cannabis Management is expected to license retail stores on non-tribal lands sometime in 2025. Additionally, the 2023 legalization of adult-use cannabis included measures to expunge the criminal records of individuals who had previously been convicted for cannabis possession in Minnesota. In 2023, amendments to state statutes changed the definition and legality of drug paraphernalia. The possession of all drug paraphernalia is no longer a crime in Minnesota, even if that paraphernalia contains residual amounts of controlled substances. (Minn. Stat. § 152.025 subd. 2). Syringes and any drug checking instruments used for “testing the strength, effectiveness, or purity of a controlled substance” are no longer considered drug paraphernalia. (Minn. Stat. § 152.01 subd. 18). It is still unlawful for any person to manufacture paraphernalia for delivery. (Minn. Stat. § 152.093). Subd. 18.Drug paraphernalia. (a) Except as otherwise provided in paragraph (b), "drug paraphernalia" means all equipment, products, and materials of any kind, except those items used in conjunction with permitted uses of controlled substances under this chapter or the Uniform Controlled Substances Act, which are knowingly or intentionally used primarily in (1) manufacturing a controlled substance, (2) injecting, ingesting, inhaling, or otherwise introducing into the human body a controlled substance, or (3) enhancing the effect of a controlled substance. (b) "Drug paraphernalia" does not include the possession, manufacture, delivery, or sale of: (1) hypodermic syringes or needles or any instrument or implement which can be adapted for subcutaneous injections; or (2) products that detect the presence of fentanyl or a fentanyl analog in a controlled substance. Present considerations: Current city code defines drug paraphernalia related to the use of marijuana as a violation of M.S.A. Chapter 152. The new language in state statute exempts items used in conjunction with permitted uses of controlled substances. The recent legalization of cannabis as a controlled substance removes items used to ingest, inhale or otherwise introduce cannabis flower or cannabis products into the human body from the definition of “drug paraphernalia”. The city attorney has advised an ordinance amending city code section 18-94 referencing drug paraphernalia to no longer include items related to marijuana. The introduction of legalized cannabis is likely to generate public demand for cannabis paraphernalia. As these items are no longer by definition “drug paraphernalia”, the city is expecting retail businesses to have an increased interest in offering them for sale. Staff and the city attorney have discussed regulatory measures to ensure the health and safety of the community while allowing for the sale of cannabis paraphernalia. Staff is recommending Special study session meeting of February 3, 2025 (Item No. 3) Page 3 Title: Proposed amendments to city code chapters 8 and 18 related to tobacco licensing and definitions of drug paraphernalia amending city code chapter 8, subdivision X to limit retail sale of cannabis paraphernalia to those businesses which hold an active tobacco license. Retail sales of cannabis paraphernalia would be similar to tobacco; all such products shall be stored behind a counter or other area not freely accessible to customers. In addition, licensed cannabis retailers are allowed to sell cannabis related devices under state law. Next steps: The following table outlines future actions for the proposed amendments to the city code. In addition to publication of the ordinance, current tobacco license holders will be notified in advance of the proposed changes per state law. Future actions Governing body Date First reading of amendments to city code chapters 8 and 18 City council March 3, 2025 Second reading of amendments to city code chapters 8 and 18 City council March 17, 2025 Amendments to city code chapters 8 and 18 n/a April 11, 2025 Meeting: Special study session Meeting date: February 3, 2025 Written report: 4 Executive summary Title: Cannabis and lower-potency hemp retail registration Recommended action: No action at this time, unless council requests further discussion on policy direction for cannabis and lower-potency hemp retail registration prior to first reading. Policy consideration: • Does council wish to adopt a retail sales registration ordinance for retailers of cannabis products and lower-potency hemp edibles or transfer authority to the county? • If council wishes to adopt a city ordinance on this issue, does council support the ordinance provisions within the report? Summary: In 2023, the State of Minnesota passed legislation to legalize the possession, use, manufacturing and sale of certain cannabis products. The law establishes the Office of Cannabis Management (OCM) to regulate the commercial production and sale of cannabis related products. Municipalities have the authority to enact certain regulations related to zoning, local registration, and enforcement of state regulations regarding cannabis sales. The OCM is nearing completion of the rulemaking process and anticipates issuing licenses of cannabis retail sales in the coming months. When the state first legalized hemp derived lower-potency cannabinoids, council approved regulatory measures to provide safe, convenient and equitable access for adult use. With the recent legalization of cannabis, the OCM is requiring retail registration by either the city or county as part of their licensing process for all retail sales of cannabis and lower-potency hemp products. City registration would allow for additional regulations permitting limits on the number of retailers, hours of operation, and local compliance checks. Staff recommends council adopt an ordinance for registration of cannabis and lower-potency hemp product retailers providing additional measures of control for the health and safety of the community as legalized cannabis products enter the market per state law. The first reading of the ordinance and a public hearing to establish the registration fee are scheduled for March 3, 2025. The current city-issued hemp edible license remains in effect until the state begins licensing. A future ordinance to repeal the hemp edible license will be considered at that time. Financial or budget considerations: Annual retail registration fees for cannabis and lower- potency hemp sales and the required staff time will be minimal due to the limited number of cannabis retailers and the maximum registration fee limited by state statute. Revenue estimates are between $5,000 to $10,000 annually with first year slightly higher due to initial fee added for new retailers. Strategic priority consideration: Not applicable. Supporting documents: Discussion Prepared by: Michael Pivec, property maintenance & licensing manager Reviewed by: Brian Hoffman, building and energy director Approved by: Kim Keller, city manager Special study session meeting of February 3, 2025 (Item No. 4) Page 2 Title: Cannabis and lower-potency hemp retail registration Discussion Background: In its 2022 legislative priorities, the council approved the following position on adult use of cannabis: • The City of St. Louis Park supports efforts at the state legislature to legalize the use of cannabis for recreational purposes by adults and further supports using funds raised from taxes on sale of cannabis to remediate negative effects that may result from legalization. In 2023, the State of Minnesota passed legislation to legalize the possession, use, manufacturing and sale of certain cannabis products. The law establishes the Office of Cannabis Management (OCM) to oversee the regulation of commercial production and sale of cannabis related products. The formal rulemaking process is nearing completion as the OCM published a notice of intent to adopt rules on Jan. 13, 2025 which starts a 30-day public comment period ending on Feb. 12, 2025. The legislation allows for 13 different types of business licenses listed in the table below. The OCM will also issue endorsements to license holders to engage in specific activities such as producing, manufacturing, and sale of medical cannabis for patients. The following table shows the business activities allowed under each license type. Business activity License type Retail Manu- facturing Cultivation Wholesale Other Cannabis microbusiness X X X X X Cannabis mezzobusiness* X X X X Cannabis cultivator* X X Cannabis manufacturer* X X Cannabis retailer* X Cannabis wholesaler X Cannabis transporter X Cannabis testing facility X Cannabis event organizer X Cannabis delivery service X Lower-potency hemp edible retailer X Lower-potency hemp edible manufacturer X Medical cannabis combination business X X X X *License types with a statewide cap on the number of licenses available in the general licensing process. The statewide caps are 100 licenses for mezzobusinesses, 50 licenses for cultivators, 24 licenses for manufacturers and 150 licenses for retailers. Special study session meeting of February 3, 2025 (Item No. 4) Page 3 Title: Cannabis and lower-potency hemp retail registration Local Retail Registration Process (342.22): Several license types are authorized to conduct retail sales including those with retail endorsements from OCM. Prior to conducting retail sales under their business license, state law also requires the business receive a local retail registration from the city or county. There are five state license types that are eligible to conduct cannabis retail sales with a local registration: • Cannabis retailers • Microbusinesses • Mezzobusinesses • Medical cannabis combination businesses • Lower-potency hemp edible retailers In addition, a cannabis event organizer license authorizes temporary cannabis events lasting no more than four days. Local governments must issue a retail registration after verifying that: • The business has a valid license issued by OCM. • The business has paid a registration fee or renewal fee to the local government. Initial registration fees collected by a local government may be $500 or half the amount of the applicable initial license fee, whichever is less, and renewal registration fees may be $1,000 or half the amount of the applicable renewal license fee, whichever is less. • The business is found to be in compliance with Chapter 342 and local ordinances. • If applicable, the business is current on all property taxes and assessments for the proposed retail location. Certification process (342.13; 342.14): During the application and licensing process for cannabis businesses, OCM will notify a local government when an applicant intends to operate within their jurisdiction and request a certification as to whether a proposed cannabis business complies with local zoning ordinances, and if applicable, whether the proposed business complies with state fire code and building code. According to Minnesota’s cannabis law, a local unit of government has 30 days to respond to this request for certification of compliance. If a local government does not respond to OCM’s request for certification of compliance within the 30 days, the cannabis law allows OCM to issue a license. OCM may not issue the final approval for a license if the local government has indicated they are not in compliance. Present considerations: The OCM is anticipated to begin licensing cannabis retailers and lower-potency hemp edibles in the months ahead. City staff recommends establishing a cannabis business registration program rather than transferring registration authority to the county. City registration allows for added measures of control helping ensure the health, safety and economic well-being of the community. City registration of cannabis retailers allows for: • Local units of government may suspend the retail registration of the cannabis business or hemp business not operating in compliance with the requirements of local ordinance Special study session meeting of February 3, 2025 (Item No. 4) Page 4 Title: Cannabis and lower-potency hemp retail registration authorized under section 342.11 or the operation of the business posing an immediate threat to the health or safety of the public. • A local government unit that issues a cannabis retailer registration under section 342.22 may, by ordinance, limit the number of licensed cannabis retailers, cannabis mezzobusinesses with a retail operations endorsement, and cannabis microbusinesses with a retail operations endorsement to no fewer than one registration for every 12,500 residents. o Note: Retail registrations for lower-potency hemp edible retailers and medical cannabis combination businesses are required but may NOT be limited in number by a local government. If a county has one active registration for every 12,500 residents, a city or town within the county is not obligated to register a cannabis business. • Cannabis event organizers must obtain local approval for temporary cannabis events, including any necessary permits. A city permit or license can restrict or prohibit on-site consumption. There are several provisions that will be worked into the ordinance, should council support establishing it. They include: 1. Number of registrations issued 2. Selection process 3. Hours of operation 4. Registration fee 5. Inspections and compliance checks Staff has outlined the decision points below along with recommendations. Limit retail registrations: In October 2024, council discussed initially limiting the number of cannabis retailers allowed within the city per the state formula at the minimum of one retailer per 12,500 residents. The city population is on the cusp of either four or five retailers allowed, depending on annual state demographer data. Upon further review during drafting of the ordinance and evaluating administering the program, staff is recommending establishing a fixed limit of five cannabis retailers at this time. An ordinance provision based on the state formula would mean the city’s population would need to be checked every year and the allowable limit possibly changed as population rises and falls. The ordinance would need provisions and administration making it more difficult to accommodate a scenario with a possible drop in allowable retailers from five to four in years ahead. Using five as a fixed number ensures compliance with state minimums for future population growth to 62,500 or until council would choose to increase or eliminate the maximum. Recommendation: limit to 5 retailers Note: retail registrations for lower-potency hemp edible retailers and medical cannabis combination businesses are required but may NOT be limited in number by a local government. Special study session meeting of February 3, 2025 (Item No. 4) Page 5 Title: Cannabis and lower-potency hemp retail registration Local government selection: The ordinance would place applicants on a first-come, first-served basis until all available registrations are filled, and limit businesses to one retail location. By limiting businesses to one location, it allows more opportunity for diverse ownership among retail cannabis businesses. Note: Certain cannabis licenses allow for multiple retail locations to be operated under a single license, with the following limitations: • Retailers: up to five retail locations. • Mezzobusinesses: up to three retail locations. • Microbusinesses: up to one retail location. • Medical cannabis combination businesses: one retail location per congressional district. Additionally, medical cannabis combination businesses may cultivate at more than one location within other limitations on cultivation. Recommendation: Process applications on a first-come, first-served basis. Businesses are limited to a single location. Hours of operation: The hours for cannabis retail businesses are proposed in the draft registration ordinance. Staff recommend hours and days of sale of cannabis products follow regulations for the sale of alcoholic beverages at off-sale and mirror what is allowed under state law. Currently the hours and days of sale allowed for off-sale liquor (M.S. Chapter 340A.504) are as follows: Hours of operation for retail cannabis businesses: • Sundays between the hours of 11:00 a.m. and 6:00 p.m. • Monday through Saturday between the hours of 8:00 a.m. and 10:00 p.m. • No hours of operation on Thanksgiving Day, Christmas Day, December 25 or after 8:00 p.m. on Christmas Eve, December 24. State statute prohibits cannabis businesses with a retail endorsement to sell cannabis flower, cannabis products, lower-potency hemp edibles or hemp-derived consumer products between 2:00 a.m. and 8:00 a.m. Monday through Saturday and between 2:00 a.m. and 10:00 a.m. on Sunday. City ordinance allows the prohibition of sales between 9:00 p.m. and 2:00 a.m. or between 8:00 a.m. and 10:00 a.m. Monday through Saturday and between 2:00 a.m. and 10:00 a.m. on Sunday. Recommendation: Mirror state law for allowable hours Registration fee: Recommendation: Staff is recommending the maximum allowable registration fees per 342.22 be established in fee appendix A to provide fee-for-service reimbursement of city costs: • Initial Cannabis microbusiness $0, Annual Cannabis Microbusiness $1,000 • Initial Cannabis Mezzobusines $500, Annual Cannabis Mezzobusiness $1,000 • Initial Cannabis Retailer $500, Annual Cannabis Retailer $1,000 Special study session meeting of February 3, 2025 (Item No. 4) Page 6 Title: Cannabis and lower-potency hemp retail registration • Initial Medical combination $500, Annual Medical combination $1,000 • Initial Lower-Potency hemp edible retail $125, Annual Lower-Potency hemp edible retail $125 Inspections & Compliance Checks: Staff will conduct compliance checks for cannabis and hemp businesses holding retail registration at least once per calendar year. Compliance checks verify compliance with age verification procedures and compliance with any applicable local ordinance established pursuant to section 342.13. OCM maintains inspection authorities for all cannabis licenses to verify compliance with operation requirements, product limits and other applicable requirements of Chapter 342. • Restrictions on sales Preventing accessibility of cannabis and low-potency products is paramount to the health and safety of youth and adolescents. Like tobacco & liquor sales, cannabis and cannabinoid product sales are prohibited by means of self-serving merchandising including any type of vending machine and must be stored behind a counter or other areas not freely accessible to customers. Sale is prohibited to any person under the age of 21. Packages remain sealed until purchased by the customer and remain sealed on the licensed premises with exception for food and beverage establishments selling lower-potency hemp products. • Police background check Verification and investigation of applicant information helps ensure credibility of the business seeking licensure and authorizes additional investigation as deemed necessary. Recommendation: Conduct annual compliance checks, model sale restrictions and background check verification, similar to tobacco, liquor and lower-potency hemp product licenses. Next steps: The following table outlines future actions for the proposed cannabis retail sales ordinance. Future actions Governing body Date First reading of cannabis retail sales ordinance City council March 3, 2025 Second reading of cannabis retail sales ordinance City council March 17, 2025 Cannabis retail sales ordinance goes into effect n/a April 11, 2025