Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2017/04/17 - ADMIN - Agenda Packets - City Council - Regular
AGENDA APRIL 17, 2017 5:00 p.m. SPECIAL STUDY SESSION – Community Room Discussion Item 1. 5:00 p.m. Walker Building, 6524 Walker Street 2. 6:00 p.m. Vision 3.0 Trends Exercise Written Reports 3. Advancing Race Equity: Next Steps for 2017 4. Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 7:20 p.m. ECONOMIC DEVELOPMENT AUTHORITY -- Council Chambers 1.Call to Order 2.Roll Call 3. Approval of Minutes 3a. Economic Development Authority Meeting Minutes March 20, 2017 4. Approval of Agenda 5.Reports -- None 6.Old Business – None 7.New Business 7a. Grant Applications for the PLACE Project Recommended Action: 1)Motion to Adopt EDA Resolution authorizing the submission of a grant application to the Department of Employment and Economic Development (DEED) Contamination Clean-up Grant Program on behalf of the PLACE project; 2)Motion to Adopt EDA Resolution authorizing the submission of a grant application to the Metropolitan Council Tax Base Revitalization Grant Program on behalf of the PLACE project; 3) Motion to Adopt EDA Resolution authorizing a grant application to the Metropolitan Council Livable Communities Transit Oriented Development (LCA-TOD) Program for development activities for PLACE. 7b. Excelsior & Monterey Redevelopment Recommended Action: Motion to deny the TIF application and decline the Developer’s offer to purchase the property at 3743 Monterey Drive. 8.Communications -- None 9.Adjournment Meeting of April 17, 2017 City Council Agenda 7:30 p.m. CITY COUNCIL MEETING – Council Chambers 1. Call to Order 1a. Pledge of Allegiance 1b. Roll Call 2. Presentations 2a. St. Louis Park Parktacular Ambassadors Introduction & Recap of Year 2b. Volunteer Proclamation 2c. 2017 Arbor Day Proclamation 2d. 2017 International Compost Awareness Week Proclamation 2e. 3rd Annual SLP Earth Day Proclamation 2f. Recognition of Donations 3. Approval of Minutes 3a. Special Study Session Meeting Minutes March 20, 2017 3b. City Council Meeting Minutes March 20, 2017 3c. Special Study Session Meeting Minutes April 3, 3017 4. Approval of Agenda and Items on Consent Calendar NOTE: The Consent Calendar lists those items of business which are considered to be routine and/or which need no discussion. Consent items are acted upon by one motion. If discussion is desired by either a Councilmember or a member of the audience, that item may be moved to an appropriate section of the regular agenda for discussion. The items for the Consent Calendar are listed on the last page of the Agenda. Recommended Action: Motion to approve the Agenda as presented and items listed on the Consent Calendar; and to waive reading of all resolutions and ordinances. (Alternatively: Motion to add or remove items from the agenda, or move items from Consent Calendar to regular agenda for discussion.) 5. Boards and Commissions -- None 6. Public Hearings 6a. Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements Recommended Action: Mayor to open public hearing, take public testimony, and close public hearing. Motion to approve the first reading of an ordinance amending the St. Louis Park Home Rule Charter related to Municipal Primary Elections and Candidate Filing Requirements. A unanimous vote of all 7 councilmembers is required for approval. 6b. PLACE Private Activity Revenue Bonds Financing (Housing) Recommended Action: The Mayor is asked to open the public hearing, take testimony and then close the hearing. The recommended action is then as follows: Motion to Adopt Resolution Authorizing the issuance and sale of multifamily housing revenue obligations for the benefit of VIA Affordable Living Limited Partnership: authorizing the execution and delivery of documents related thereto; adopting a housing program; and taking certain other actions. 7. Requests, Petitions, and Communications from the Public – None Meeting of April 17, 2017 City Council Agenda 8. Resolutions, Ordinances, Motions and Discussion Items 8a. PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final Planned Unit Development Recommended Action: • Motion to Adopt Resolution approving the Comprehensive Plan Land Use Map Amendment (requires 5 affirmative votes); and • Motion to approve First Reading of Ordinance adding Section 36-268-PUD 9 to the Zoning Code and amending the Zoning Map from IG-General Industrial and MX- Mixed Use to PUD 9 for the property located at the southeast quadrant of highway 7 and Wooddale Avenue and the northeast corner of West 36th Street and Wooddale Avenue, and set the second reading for May 1, 2017 (requires 4 affirmative votes). 8b. Excelsior & Monterey (Bridgewater Dominium Addition) Preliminary Plat and Preliminary PUD Recommended Action: Motion to Adopt Resolution denying rezoning to Planned Unit Development and denying preliminary plat with variances. 8c. Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Recommended Action: Motion to Adopt Resolution rescinding Resolution No. 03-180 and approving the attached revised list of snow removal exempt parking areas. 8d. Resolution Supporting Local Decision-Making Authority Recommended Action: Motion to Adopt Resolution supporting local decision-making authority. 9. Communications – None Auxiliary aids for individuals with disabilities are available upon request. To make arrangements, please call the Administration Department at 952/924-2525 (TDD 952/924-2518) at least 96 hours in advance of meeting. Meeting of April 17, 2017 City Council Agenda CONSENT CALENDAR 4a. Approve a Temporary On-Sale Intoxicating Liquor License for Finnegans Community Fund at Gamble Drive and the adjacent privately owned parking lot in West End for May 20, 2017. 4b. Authorize execution of an amendment to a professional services contract with WSB and Associates in the amount of $346,216 for the W. 37th Street Bridge and Road Reconstruction Project (Boone Ave. to Aquila Ave.) Project No. 4017-1700. 4c. Designate Allied Blacktop Co. the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $360,172.79 for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200). 4d. Designate G.L. Contracting, Inc. the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $708,909.67 for the 2017 Connect the Park Bikeway, Sidewalk and Trail - Project No. 4017-2000. 4e. Adopt Resolution authorizing entering into Agency Agreement No. 1027745 with MnDOT for the W. 37th Street Bridge and Road Reconstruction Project (Boone Ave. to Aquila Ave.) Project No. 4017-1700. 4f. Approve the 2017/2018 Neighborhood Grants. 4g. Adopt Resolution approving acceptance of a grant from the Minneapolis Auto Club Foundation for Safety in the amount of $1,000 for the purchase of Safety Camp t-shirts as a part of the annual Safety Camp event. 4h. Adopt Resolution approving acceptance of a monetary donation from Becky Finnigan in the amount of $1,000 for park maintenance and enhancements at Westwood Hills Nature Center. 4i. Adopt Resolution approving acceptance of a scholarship from Minnesota Government Finance Officers Association (MNGFOA) for registration, hotel, and transportation expenses for Tim Simon, Chief Financial Officer to attend the 2017 Advanced Government Finance Institute held July 30th – August 4th, 2017 in Madison, Wisconsin in an approximate amount not to exceed $2,300. 4j. Adopt Resolution authorizing the Mayor and City Clerk to sign the joint powers agreement for the Criminal Justice Data Communications Network as maintained by the BCA. 4k. Approve for filing Planning Commission Minutes of March 8, 2017. St. Louis Park Economic Development Authority and regular City Council meetings are carried live on Civic TV cable channel 17 and replays are frequent; check www.parktv.org for the schedule. The meetings are also streamed live on the internet at www.parktv.org, and saved for Video on Demand replays. The agenda is posted on Fridays on the official city bulletin board in the lobby of City Hall and on the text display on Civic TV cable channel 17. The agenda and full packet are available by noon on Friday on the city’s website. Meeting: Special Study Session Meeting Date: April 17, 2017 Discussion Item: 1 EXECUTIVE SUMMARY TITLE: Walker Building - 6524 Walker Street RECOMMENDED ACTION: Staff desires direction from the Council as to its wishes regarding the future of the Walker Building. POLICY CONSIDERATION: Should the City play some type of direct role in the future of this property? SUMMARY: The St. Louis Park Historical Society (HS) has been looking for a permanent home for some time now. The property at 6524 Walker St. is up for sale and has been identified by the HS as a possible location for them. This building dates back to 1892 and it is city staffs understanding it is the oldest commercial structure remaining in the community. Here is a link to the Historical Society’s web site that provides a wealth of information about the property http://slphistory.org/walkerbuilding/. Staff had a meeting in January with HS representatives about this property. It was made clear that the HS desired the City to play a significant role in somehow securing the building for their use. At that time staff suggested that the HS put together a proposal that was supported by the HS Board for presentation to the Council. Here is some current background information on the property: • The gross building area is 18,450 square feet • The 2017 valuation is $573,000 • The property is currently listed by Terra Firma (Thomas Dunn is the listing broker). The current list price on the property is $775,000, which is down from the original list price of $825,000 in the fall of 2015. Please note that other than a recent site visit, staff has not done any due diligence on this property. FINANCIAL OR BUDGET CONSIDERATION: Not applicable at this time. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: None Prepared by: Tom Harmening, City Manager Meeting: Special Study Session Meeting Date: April 17, 2017 Discussion Item: 2 EXECUTIVE SUMMARY TITLE: Vision 3.0 Trends Exercise RECOMMENDED ACTION: The Council is asked to take part in the Vision 3.0 Trends Game, which is an exercise to sort and prioritize major trends that will affect the future. POLICY CONSIDERATION: What are the biggest trends that may impact the future of St. Louis Park? SUMMARY: At the Special Study Session, our Vision 3.0 consultant Rebecca Ryan will facilitate a Trends Game, which is a process in which the City Council and Department Directors will sort and prioritize the trends that will have the largest impact on St. Louis Park in the next 20 years. This is part of the Vision 3.0 project, and will be used to prepare the city’s Vision for the future. The four big trends categories are: Resources, Technology, Demographics and Governance. Participants were assigned to review one of the categories as discussed in “The Next Big Things” report which is attached. At the meeting four groups as assigned (see discussion section) will meet to discuss and prioritize the trends. NEXT STEPS: Vision 3.0 activities continue throughout the next several weeks, including: § Facebook Live Town Hall meeting Thursday, April 13, 8 p.m. via the city Facebook page @stlouispark. § Additional Facilitator Training, Tuesday, April 18th, 7:30-8:45 a.m. at Lenox Community Center. There is still room available and registration is open until April 14th at http://bit.ly/2ng2zzm. § Vision 3.0 Questions of the Week are posted each week on Facebook, Twitter or Nextdoor. § Community conversations are taking place in many places throughout the community. § Chalkboards will be placed at community events and venues in the city from March through May. This will allow people to write down their one wish for St. Louis Park. § Online outreach and opportunities for input will continue over the next few months. § The city’s website is updated continually with Vision events and activities, including facilitator-led discussions that are open to the public. FINANCIAL OR BUDGET CONSIDERATION: Any expense for the activities being undertaken are accounted for in the Development Fund budget. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Discussion The Next Big Things Report Prepared by: Meg McMonigal, Principal Planner Reviewed by: Kevin Locke, Community Development Director Approved by: Tom Harmening, City Manager Special Study Session Meeting of April 17, 2017 (Item No. 2) Page 2 Title: Vision 3.0 Trends Exercise DISCUSSION Following are the trend groups for the Trends Exercise. Trend Area Assignment Review the Resource Trends on pages 11-17 Tim Brausen Nancy Deno Steve Hallfin Mike Harcey Tom Harmening Review the Technology Trends on pages 18-33 Deb Heiser Brian Hoffman Steve Koering Gregg Lindberg Review the Demographic Trends on pages 34-45 Kevin Locke Anne Mavity Thom Miller Clint Pires Review the Governance Trends on pages 46-59 Sue Sanger Michele Schnitker Jake Spano Cindy Walsh THE NEXT TWENTY YEARS IN LOCAL GOVERNMENT @transformgov START NOW Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 3 The Alliance for Innovation is inspiring innovation to advance communities. As the premier resource for emerging practices in local government, the Alliance is building cultures of innovation and connecting thought leaders in the profession with the help of our partners ICMA and ASU. We are accessible and valuable to all levels of an organization. transformgov.org Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 4 3 CONTENTS I. ARE WE FUTURE READY? An open letter from the Alliance for Innovation .....................................04 II. FOUR FORCES AND 44 TRENDS III. FOUR FUTURE SCENARIOS Scenario One: The Official Future .............................................................62 Scenarios Two: Nomentum ....................................................................63 Scenario Three: We’re Not Gonna Take It ....................................................64 Scenario Four: Democracy V.3.0 ..............................................................65 IV.PUTTING THE NEXT BIG THINGS TO WORK ..................................66 V.PREMIUM TOOLS AND RESOURCES The Big Sort Designing Community Scenarios Foresight Workshop Kit VI. METHODOLOGIES AND REFERENCES ............................................76 VII. ACKNOWLEDGEMENTS ..................................................................82 Technology Trends 18 Resource Trends 11 Demographic Trends 34 Governance Trends 46 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 5 I.ARE WE FUTURE READY? #NBT Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 6 5 An Open Letter from the Alliance for Innovation When the Alliance for Innovation completed its recent strategic plan, we committed to discovering the “next big things” facing local governments. We challenged ourselves to look beyond the horizon we could see, and imagine what our cities and counties might look like one generation from now. It was an audacious task, undertaken to ensure that our members and their successors—the most innovative city and county leaders on the planet—are well equipped to face the future, whatever it holds. We chose a twenty-year time horizon. Why? Twenty years is the average length of a generation. Thinking twenty years into the future enables us to get out of our own way and imagine a future beyond ourselves when many of us will be retired, or handing the reins to our successors. Thinking of the kinds of communities our children and grandchildren will inherit - and the communities we have served and loved - often brings out the best in us: we want to imagine the greatest number of possibilities and when those possibilities impact those we love, we bring focus to the task. But thinking twenty years into the future is also difficult. The human brain is hard-wired for pattern recognition. And patterns, by their nature, are based on events that have already happened. Because the brain is not geared for future thinking, we used a set of tools, Strategic Foresight, and a team of trained Futurists to guide this process. The timing is terrific. Many experts and city professionals say that we are entering “the city century”, an era when local government will definitively surpass regional, state, and national governments as the lead innovators in how we deal with change - from climate change to infrastructure financing, from mobility to education, urbanization, and beyond. To identify the next big things, we worked with experienced and emerging professionals, a global panel of subject matter experts, and all the data available to us. As you’ll learn, some of the next big things aren’t “big” in a traditional sense; they’re pernicious, quietly growing in strength over time. Others are surprising, and communities must choose whether to ignore, mitigate, or adapt. Whether you’re a member of the Alliance for Innovation or not, we expect that The Next Big Things will influence your local government conversation. But even more, we hope it will help your community get future-ready. The future, after all, doesn’t just happen to us. The future passes through us. And the future starts now, Karen Thoreson President, Alliance for Innovation September 23, 2015 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 7 II. FOUR FORCES AND FORTY-FOUR TRENDS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 8 7 If we asked you, “What trends are impacting your community?” you could probably fill a large whiteboard. Twice. To help organize and prioritize the trends impacting communities in the next twenty years, we use the Four Forces model developed by futurist Cecily Sommers. These four forces are agents of mega-change; if any of the four forces are undergoing drastic change or disruption in your community, it will likely mark a significant shift in how citizens act, engage, and respond to each other, and to their government. In priority order, the Four Forces are: Resources The availability of resources is most closely tied to survival, so it is the most important force. Resources include the food, water, air, habitat, and other material nature offers. Especially important are the resources that enable energy production. Trends and resource drivers related to this force include: climate, ocean, space, energy, minerals, water, land, food, animals and forest. Technology Technology includes the tools and knowledge we use to extract and transform resources into new products and capacities that make our lives more comfortable and convenient, or to develop capabilities beyond our physical bodies that allow us to go places and discover new realities. Trends and drivers related to this force include: genetics, robotics, information, nanotechnology, health care, education, collaboration, virtual reality, games, telephony, manufacturing, infrastructure, and capital formation. II. FOUR FORCES AND FORTY-FOUR TRENDS 1 2 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 9 8 Demographics Demographics is the “who” behind society’s changes. People are producers. We produce through our physical and intellectual labor, so “who” is producing matters, e.g. does your community have enough working people to support your very young and very old; do you have the right ratio of women to men; is there enough social cohesion among groups to ensure the good of the community? Trends and resource drivers related to this force include: population growth, the developing world, industrialization, immigration, multiculturalism, multilingualism, nationalism, and conflict. Governance Distribution and management of society’s assets—resources, technology and people—are administered through the rule of law and the rule of markets. Of all the forces, governance is the most reactive, i.e. changes in resources, technology and people often run ahead of government’s capability to deal with them. Trends and drivers related to this force include: tribalism, market drivers, values, interests, beliefs, online communities, personalization, polarization, and identity politics. Communities can use the Four Forces model as a way to organize and prioritize the trends impacting them. For innovative city and county leaders, it’s sobering to think that you can have the best-run local government (the fourth force), but if there is a serious resource shortage (the first force), an abrupt technology change (the second force), or a significant in-migration or out-migration of people (the third force) it won’t matter; change will be forced upon you. Understanding the four forces and their order of importance is fundamental to building a future-ready community. In the following pages, we outline these forty-four trends: THE NEXT BIG THINGS 3 4 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 10 9 Resource Trends 1.Climate Change 2.Food Insecurity 3.Water Shortages & Access 4.Energy Grid Disruption (U.S.) 5.Mining 6.The “NORC” Shift Technology Trends 7.Digital Citizens 8.Sharing Economy 9.Education Reform 10.Open Innovation 11.Behavioral Insights 12.Unmanning 13.Decentralized Manufacturing & 3-D Printing 14.Global, Digital Currency 15.Carless Communities 16.Infrastructure Overhaul 17.New Financial Partnerships 18.Microgrids 19.Off-Gridding 20.Electric Vehicles 21.Water Recycling 22.Desalinization 23.Nanotechnology 24.Tech-Enabled Health Care 25.Biomimicry II. FOUR FORCES AND FORTY-FOUR TRENDS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 11 10 Demographic Trends 26.Tribalism & Identity Politics 27.Structural (Youth) Unemployment 28.Civil Rights Spring 29.Mass Migration 30.Middle Class Map 31.Elder Expense 32.Urbanization: Mega & Mid-Sized 33.Rural v. Urban 34.Smart Citizens 35.Nomadic Workforce 36.Hyper-Localization Governance Trends 37.Declining Federal Government Effectiveness 38.Trust in Government 39.City-to-City Collaboration 40.VUCA Leadership 41.Citizen Engagement 42.Direct Democracy 43.Corporate and Special Interest Influence 44.Fiscal Uncertainty THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 12 Resource Trends Author: Robin K. White, Ph.D., Senior Mediator and Program Director, Meridian Institute I have had the distinct pleasure to work with thought leaders around the world on developing resilient communities — communities that, when hit with an unexpected and disruptive event, can bounce back even stronger. But this takes work. And planning. As the Chinese proverb says, “The best time to plant a tree was twenty years ago. The second best time is now.” Being a resilient community means investing now, to be future-ready. Resilient communities honestly assess their vulnerabilities and their assets, and are willing to consider the worst case. This isn’t headline-grabbing work. It won’t make you popular. And it doesn’t win elections. But when your community is rocked by disaster, this is the work that gives us a path forward, through the mess. Your community has an incredible opportunity to start building its resilience. This document, The Next Big Things, lays out dozens of trends that may affect your community. Chief among them are the Resource Trends on the following pages. Your community’s understanding of its resources is the most important factor impacting your resilience. Because when your community loses its flow of clean water or affordable energy, nothing else matters. People panic. If you’re prepared, you have a way to handle it, to engage people and reroute their emotional energy toward a productive path. A responsible resilience plan demands that your community understand its resource trends and limitations. Start here. And if your community discovers that its resources are limited, constrained, or vulnerable, consider it a blessing. Time and again, I have seen communities face the facts squarely, and seen how creative and inspired their solutions can be. Finally, I strongly encourage you to have this discussion about resources and resilience within neighborhoods, at churches, and on the front lines. Top-driven responses to major disruptions often fall short; preparation by local residents is more effective because everyday residents are the ones who will have to live and work through any catastrophe or resource shortage. I encourage you in your journey to take the long-term view on your resources, and be future-ready. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 13 12 Which of these trends might be the “next big thing” in your community? Climate Change Over the next twenty years, climate change will be the most important resource issue facing local governments. Climate change affects our oceans, fresh water, arable land and food sources, and animals. Not only are climate-change events like rainstorms, hurricanes and tornadoes growing more intense, the cost of their damages is increasing over time: Cities and counties are responding. MIT’s Alexander Aylett conducted a global survey of cities’ responses to climate change and found that Canadian municipalities are international leaders, weaving climate-change plans into other local government department plans, long-range plans, and sustainable development plans. Globally, levels of integration vary by country and region. The United States however is the only country where cities report consistently low levels of integration across different local government plans.1 1 Aylett, Alexander. 2014. Progress and Challenges in the Urban Governance of Climate Change: Results of a Global Survey. Cambridge, MA: MIT. THE NEXT BIG THINGS 600 500 400 300 200 100 0 400 350 300 250 200 150 100 50 0 Source: The International Disaster Database, EM-DAT databaseNumber of occurrences of natural disastersToatal damage (USD billion)1980199419872001198119951988200219821996198920032008198319971990200420091984199819912005201019851999199220062011198620001993200720122013Number of occurrences of natural disasters Toatal damage (USD billion) 1 Figure 1. Economic Consequences of Global Increase in Occurrence of Severe Weather Events Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 14 13 Local governments use many tools to mitigate climate change through the reduction of greenhouse gases as Aylett’s’ research shows in Figure 2 below The following issues are closely linked to climate change, but may impact communities at various levels of intensity: Food Insecurity As the planet gets hotter, droughts will drag on longer and with greater intensity. This will lead to decreases in food production, and increases in food prices. For example, the United States is the lead producer of corn and soya beans, two of the most important primary crops in the world. In 2012 the U.S. Department of Agriculture declared over half of all counties “disaster areas” due to drought.2 As corn and soy crops wilted in the heat, food prices increased. This led hungry and desperate people in 28 countries to riot. Links between climate change, food insecurity and political instability have been made in Syria,3 North Korea, Iran and Somalia.4 And as food like corn is being diverted to energy production, food prices may become more unstable. To offset these possible food price shocks and 2 Michael Muskal, “As drought widens, 50.3% of U.S. counties declared disaster areas,” Los Angeles Times, August 1, 2012 3 Colin P. Kelley, Shahrzad Mogtadi, et. al., “Climate change in the Fertile Crescent and Implications of the recent Syrian Drought,” Proceedings of the National Academy of Sciences, March 2, 2015 4 Johanna Nesseth Tuttle and Kristin Wedding, “Will Food Prices Drive Instability,” Global Forecast 2012, Center for Strategic and International Studies II. FOUR FORCES AND FORTY-FOUR TRENDS 100% 80% 60% 40% 20% 0% local government Buildings local government vehicle fleet landfill gas capture increased public transit use reduced use of private cars, trucks, or motorcycles freight and shipping local business local industry residential energy use waste reduction residential green building policies or programs commercial green building policies for business and/or industry reduction of upstream emissions through purchasing policies other ● ● ●● ● ● ●● ● ● ● 2 Source: Alexander Aylett, Progress and Challenges in the Urban Governance of Climate Change Figure 2. Where Cities Have Made Measurable Emissions Reductions: Global Results ● ●● Top Global Answers Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 15 14 instability, the G20 is forging agreements on smoother import and export practices (banning protectionism) in an effort to keep food prices relatively stable worldwide. In addition, the private sector is increasingly being called on to offer support for food security and agricultural investment around the world. Water Shortages & Access The steady march of climate change is forging ahead and is having a huge impact on water availability. Droughts like the one we are facing now will become more common in the future, and likely even more severe, especially later in the century. It is climate change that is making drought the new normal, and we need to adjust our personal thinking, and our statewide and national water management accordingly. - Jay Famiglietti, Senior Water Scientist, NASA Jet Propulsion Laboratories THE NEXT BIG THINGS 3 Figure 3. Change in Precipitation by End of 21st Century, Inches of Liquid Water Per year 60 45 30 20 10 6 4 3 2 1 -1 -2 -3 -4 -6 -10 -20 -30 -45 -60 AS PROJECTED BY NOAA/GFDL CM 2.1 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 16 15 By 2025, two-thirds of the world’s population will be living in water-stressed conditions. By 2030, half of the world’s population will live in “high water stress” areas. The following maps show the changes from 2010 to 2050 if we do nothing and anticipated population and economic growth proceeds as expected5: 5 “Sustaining growth via water productivity: 2030/2050 scenarios”, Veolia Water and International Food Policy Research Institute. http://growingblue. com/wp-content/uploads/2011/05/IFPRI_VEOLIA_STUDY_2011.pdf. Accessed June 30, 2015 II. FOUR FORCES AND FORTY-FOUR TRENDS Figure 4. Water Stress as a Percent of Total Renewable Water Withdrawn, 2010 Figure 5. Water Stress by 2050 Under Business As Usual, Medium Growth Scenario No Data < 20 20 - 30 30 - 40 40 - 50 >50 No Data < 20 20 - 30 30 - 40 40 - 50 >50 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 17 16 Energy Grid Disruption (U.S.) The United States’ energy grid is the most complicated machine ever built by man. We rely on it every day to charge our smart phones, power our refrigerators, operate our lights, and heat and cool our homes. But the grid’s transformers and substations were not designed to be protected from physical attack. Many of them sit idly in rural areas, protected by little more than a chain-link fences and guarded by a camera. Just how vulnerable is the grid? In 2003, trees hit transmission lines and caused a cascade of blackouts affecting 50 million people in the Eastern U.S. and Canada for days.6 And with increased storm intensity, it’s possible that something like this will happen again, disrupting financial transactions, public safety, emergency medical response, access to food, and mobility. In April 2013, Pacific Gas & Electric announced that its San Jose substation was attacked by people who cut communication cables and fired over 100 rifle bullets, knocking out 16 of 23 transformers. Although PG&E was able to route power to its customers from nearby utilities, it took 27 days to get the substation operational. Sixteen months later, the same substation was attacked again. This highlights the fragility of our grid, and its susceptibility to national or international terrorism. Many communities, and the entire state of New York, are investigating local grid development to ensure more reliable energy sources. (See trends 18, 19 and 20.) Mining Two sources of mining will unlock greater energy resources in the next twenty years. The first, hydraulic fracturing, commonly known as “fracking”, is a technique used to access natural gas. In the U.S., the energy industry refers to natural gas as a “bridge fuel” that will help make the transition from coal to renewable energy. Fracking is creating jobs in the energy sector, and is also being studied for its impacts on water and air safety. As the world’s ice recedes and the sea floor becomes accessible, deep sea mining will uncover an estimated 10 billion tons of polymetallic nodules, which are used in everything from electronics to wind turbines and hybrid cars. As with fracking, environmental concerns including the loss of habitat, are expected. 6 Rebecca Smith, “Assault on California Power Station Raises Alarm on Potential for Terrorism,” Wall Street Journal, February 5, 2014, http://www.wsj.com/articles/SB10001424052702304851104579359141941621778 7 Michael Lodge, “Deep Sea Mining: The New Resource Frontier.” 2015. Outlook on the Global Agenda. World Economic Forum. THE NEXT BIG THINGS 4 5 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 18 17 The "NORC" Shift A hotter planet will negatively affect some communities while “positively” impacting others. The “NORC”, or Northern Rim countries, lay north of the 45th parallel and will be beneficiaries of climate change. The NORC regions include Canada, Denmark, Finland, Iceland, Norway, most of Russia, Sweden and the thirteen U.S. states that are contiguous with Canada: Alaska; Washington; Idaho; Montana; North Dakota; Minnesota; Michigan; Ohio; Pennsylvania; New York; Vermont; New Hampshire; and Maine. The NORC regions will experience longer growing seasons and produce more food. And they will also have less ice, which will enable easier shipping routes and access to fuel and nonfuel resources.8 They may also be the recipients of massive in- migration from other, hotter and drier parts of the world. II. FOUR FORCES AND FORTY-FOUR TRENDS 8 Lawrence C. Smith. Four Forces Shaping Civilization’s Northern Future. Plume, 2011. 6 The NORC Regions The Northern Rim Countries FIGURE 6. MAP OF NORTHERN RIM COUNTRIES N45 NORTH OF THE 45TH PARALLEL Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 19 Technology Trends Author: Erik Johnston, Director, Center for Policy Informatics; Senior Sustainability Scientist, Julie Ann Wrigley Global Institute of Sustainability; and Associate Professor, School of Public Affairs, College of Public Service and Community Solutions, Arizona State University How does governance evolve when nearly everyone now carries around a personal supercomputer? That smart phone you carry with you is an incredibly useful tool and it is transforming the relationship between publics and their communities. It has replaced your watch, your paper maps, your need to tune-into the local news for the weather, and more. And it has replaced a passive relationship with government with a dynamic one filled with new possibilities, obligations, and consequences. At the city level, your smart phone, pooled with thousands of other “smart devices”, is making your community smarter and more connected than ever. Or at least, that’s the promise. Technology in the next twenty years will have a transformative effect on how citizens interact with their governments, what they expect from their governments, and what they can provide to their governments. Why? Because for the first time, technology allows real-time, two-way engagement. Publics that stumble across graffiti or potholes or corrupt officials can report them on the spot (the public as sensors). Publics can also show up for a government-sponsored hackathons and turn open data into new insights and apps (the public as inventors). What’s more, because of the “internet of things,” the amount of data we’re able to collect and analyze enables us to be more proactive and more effective in communicating to the public about things that really matter, like weather alerts or how to evacuate in case of a natural disaster (just in time governance customized to individual experiences). Technology could be a great enabler, improving the relationship between government and citizens. And the quality of that transformation will depend on how local governments respond. Will they see technology and greater citizen engagement as a threat or an opportunity, as a tax on their resources or an investment? As a cautionary tale, read the “Democracy 3.0 scenario” later in this document; failing to embrace technology for citizens’ effective self-governance could create mutiny. Governments will not be able to dictate which technologies are invented, or which go mainstream. Technology will always run ahead of government adoption. But, governments can control how they approach technology and what their goals are. I suggest that smart, future-ready local governments will mindfully design systems and processes that give citizens clear pathways to interact with government, and will channel their engagement for a greater, social good. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 20 19 IBM, Cisco, Google and others are in an arms race to apply technology to cities. When Larry Page announced Sidewalk Labs— Google’s new venture to improve life in cities for everyone through the application of technology to solve urban problems— he said: “By improving urban technology, it’s possible to significantly improve the lives of billions of people around the world. With Sidewalk, we want to supercharge existing efforts in areas such as housing, energy, transportation and government to solve real problems that city- dwellers face every day.” The future ready community recognizes these trends: Digital Citizens In the next 20 years, Millennials and the iGeneration (b. 2002-2022 est.) will define what it means to be a digital citizen. In their book Digital Citizenship, authors Karen Mossberger, Caroline Tolbert and Ramona McNeal define digital citizens as "those who use the Internet regularly and effectively". To qualify as a digital citizen, a person generally must have extensive skills, knowledge, and access to the Internet through computers, mobile phones, and web-ready devices to interact with private and public organizations. In a Fast Company Magazine interview, President Obama, father to two Millennials, commented on his hopes for digital citizenship: “But it’s no secret that many people feel alienated and distant from government. And I think the opportunities for us to think about how tech can empower citizens and make them feel ownership for their government is really important. Some of it is as simple as giving people quick, easy access to information about how taxpayer money is spent, or improving transparency, or being II. FOUR FORCES AND FORTY-FOUR TRENDS 7 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 21 20 able to navigate a site easily. But eventually, what we should also be thinking about is, how can technology enhance the experience of democracy? How can we make it easier to vote? How can we make it easier for like-minded citizens to petition their government in a way that is meaningful? I look at my daughters, who are, as every teenage kid is today, completely fluent in technology and social media. They might not go to a town hall meeting physically, the way their grandmother might have, and sit through a two-hour debate. Because they’re just used to things moving faster. But we can imagine creating a corollary process for them that is consistent with how they interact generally. We can think of apps that promote engagement and the power of people. Their expectations are different, and how they build communities are different. They might be less geographically based.”9 There is enormous potential for local governments to leverage technology and become more relevant to citizens. As Madeleine Albright recently noted: “Citizens are talking to their governments using twenty-first century technology. Governments are responding on twentieth century technology, giving 21st century answers.” – Madeleine Albright Sharing Economy It’s been called the sharing economy, the collaborative economy, collective consumption, or peer-to-peer (P2P) networks. Whatever you call it, it generally means eliminating the middleman to share resources, products, and services directly between users, usually via technology. ⚪Uber created technology that linked a surplus supply (drivers with cars) with unmet demand (travelers who need rides). ⚪AirBnB found a similar market opportunity: people who had extra rooms or homes (supply) were matched with people who needed a place to stay (demand). ⚪Crowdfunding matches excess capital (supply) with those who need financing (demand). THE NEXT BIG THINGS 8 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 22 21 The sharing economy is here and growing as more online consumers are willing to participate in sharing communities as Figure 7 shows. Local governments must figure out how or if to tax these services and how to manage user safety, equity, and keeping a level playing field for existing businesses, especially in light of growing fiscal uncertainty (Trend 44.) Education Reform Any discussion about the future of society must include a question about the future of education. In the U.S. for example, student achievement has been slipping for over a decade compared to other countries. At the local level, there is growing evidence that America’s public schools under-serve African-American and Latino students, who are growing in numbers. In Madison, Wisconsin— a city that’s been named a “Best Place to Live” many times — Caucasian students have an 80% likelihood of graduating from high school; African American boys have a 40% chance. And although STEM (Science, Technology, Engineering and II. FOUR FORCES AND FORTY-FOUR TRENDS Source: Nielsen and Statista 9 * based on an online survey among 30,000 consumers in 60 countries conducted in Q3 2013 Figure 7. The Rise of the Sharing Economy* Willing to share own assets Willing to share from others 78% Asia-Pacific Latin America Middle East/Africa North America Europe Global Average 81% 70%68% 52%54% 68%73%71% 43%44% 66% Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 23 22 Math) education has been an international educational focus since the 1990s, most countries have little to show for it. According to the US Department of Education, only sixteen percent of high school seniors are proficient in mathematics and interested in a STEM career.11 New models of teaching and learning will transform education, and technology will enable it, e.g. MOOCs (Massive Open Online Courses) can be customized and personalized to students across the learning continuum; rural and inner city schools will gain access to courses and resources previously unavailable including those from universities, museums and the world’s great libraries; and flipped classrooms, in which students do online coursework at home and come to school for collaboration and discussion, will be used to transform the education experience. But technology is not the cure. Educator and innovator Jordan Shapiro says: We need a cultural shift in how we think about what it means to learn because we're shifting what you need to learn. Our society is changing in crazy, enormous ways now and in ways we don't fully understand. This is one of the things that drives me crazy about the whole ed conversation: Instead of us having a conversation about what kind of society do we want to see for the next generation and how do we educate kids for that outcome, we're assuming that we all agree on what they need to learn and then finding these utilitarian solutions to try to execute that.12 Open Innovation In October 2006, Reed Hastings of Netflix announced a $1M (USD) prize for anyone or any team that could develop an algorithm to improve the accuracy of movie predictions for its customers. The “Netflix Prize” would go to the first team that could improve predictions by at least ten percent. It was a three-year competition among data geeks, mathematicians, statisticians and software engineers. It attracted more than 40,000 teams from 186 countries. It was a roll of the dice for Hastings, who’d been wrestling for years to develop a better algorithm. 11 Science, Technology, Engineering and Math: Education for Global Leadership, http://www.ed.gov/stem 12 Westervelt, Eric. 2015. Interview with Jordan Shapiro. “The Future of Education: Truths, Lies, and Wishful Thinking.” National Public Radio. THE NEXT BIG THINGS 10 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 24 23 In the end, Hastings got his algorithm. But a bigger lesson was unfolding; the winning team didn’t start as a team; they joined forces midway through the competition when they realized that their algorithms and teams were stronger together. In fact, the first time all the team members met was at the awards ceremony. As team manager Chris Volinksy explained, “You need to think outside the box, and the only way to do that is find someone else’s box.” Apple, Toshiba, Texas Instruments, Philips, BASF, GlaxoSmithKline, Procter & Gamble, GE, the BBC, US AID, and Nokia have embraced open innovation, realizing the benefits of harnessing inventiveness from outside their corporate walls. Local governments are beginning to catch the wave.13 Alliance Board Member Kevin Desouza and co-author Akshay Bhagwatwar surveyed 38 communities and determined four “technology-enabled participatory platforms” that engage the public in solving community issues14: ⚪Citizen-centric, citizen-sourced data. Citizens offer data about themselves, and other citizens analyze the data and offer insights. ⚪Citizen-centric, government open data. In this model, the government provides data, e.g. crime details, and the public is invited to analyze and assess the data, and share insights with the community and/or the city. ⚪Government-centric, citizen-sourced data. At its broadest, the government is asking for ideas from citizens. ⚪Government-centric and citizen-developed solutions. The government provides data and solicits citizens for solutions or helpful applications. New York and San Francisco have used contests to develop apps from open data. Behavioral Insights "The great majority of people in your local area pay their tax on time. Most people with a debt like yours have paid it by now." 13 “Open Innovation Success Stories,” Idea Connection, http://www.ideaconnection.com/open-innovationsuccess/ 14 Desouza, Kevin C. and Akshay Bhagwater. 2014. “Technology-Enabled Participatory Platforms for Civic Engagement: The Case of U.S. Cities.” Jour- nal of Urban Technology, 21.4, 25-50, DOI 10.1080/10630732.2014.954898. II. FOUR FORCES AND FORTY-FOUR TRENDS 11 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 25 24 These two sentences written on tax letters in Britain caused a 15% increase in ontime payments. The reason, according to Britain’s Behavioral Insights Team, is that we’re wired to behave as others do. Other behavioral insights show that things like how government forms are designed impact outcomes, e.g. Dan Ariely has shown that when organ donation is the default option, organ donation increases.15 In the next twenty years, behavioral insights, coupled with big data, will have a huge impact on local governments. Bloomberg Philanthropies is spearheading the What Works Cities initiative to apply behavioral economics to help 100 midsize U.S. cities deliver better services and become more transparent. Seattle, Boston, Louisville and San Francisco are already putting Bloomberg’s behavioral insights to the test and reaping rewards. Unmanning We have entered the age of robots, artificial intelligence (“AI”) and “smart cities”. At home, Roomba vacuums your floors. Siri or Google Voice responds to voice commands. Amazon is aggressively pursuing authority to deliver packages by drone. At work, robots do precision manufacturing and medical surgeries. IBM’s Watson can read all the medical journals ever printed in the time it takes you to drink your first cup of coffee.16 At lunch, a Ziosk tablet sits on your table, enabling customers to order food and drinks at the touch of a button, no waiter needed.17 And the Japanese government is investing millions to develop a $1,200 to $1,500 “home health aide” robot. The robots help patients remember their medications, assist in acts of daily living like using the bathroom and bathing, and provide assistance with physical therapy and socialization. The robots solve Japan’s nursing and home health aide employment shortage and enables senior citizens to stay in their homes longer. In northern cities, smart bridges deploy anti-icing agents automatically when sensors perceive the weather conditions for “black ice”. Larger cities are experimenting with road sensors that measure traffic and adjust toll prices based on congestion. The more traffic, the higher the toll. In 2014, California issued the first drivers' licenses for autonomous vehicles. 15 Ariely, Dan, “Three Main Lessons of Psychology”, http://danariely.com/2008/05/05/3-main-lessons-ofpsychology/accessed on July 12, 2015 16 Jon Gertner, “IBM’s Watson is Learning Its Way to Saving Lives.” Fast Company Magazine, November, 2012. 17 Jeff Macke, “Ziosk Could Put Waiters our of Work but not How You Think,” Yahoo Finance, October 10, 2014. THE NEXT BIG THINGS 12 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 26 25 These technologies make our lives easier. They also eliminate the need for human workers. Oxford researchers estimate that by 2035, nearly half of all occupations in America could be automated.18 This has several possible impacts. ⚪As robots and AI take over jobs that humans once did, there will be possible long-term, structural unemployment. ⚪Autonomous vehicles—which most experts agree will be on our roadways within a decade—are less accident prone and more rule-compliant than their human-driven counterparts. This could impact revenue local governments collect from car-related fees and violations. ⚪Robotics, AI and smart technology could supplant or transform many jobs currently conducted by local government employees. We already see machines replacing garbage handlers and security cameras replacing patrol personnel. Using Big Data, cities and counties could predict likely tax evaders. Property could be assessed using more indicators, resulting in more fair assessments. And routine requests for filings and forms could be handled online or via kiosks at municipal buildings. Decentralized Manufacturing & 3-D Printing Do you shop on the internet and have things delivered to your home? Or do you still shop “the old fashioned way,” by going to the store? Imagine being able to print at home what you want to buy. You could print a new doorknob or a part for an appliance. Wake Forest Baptist Medical Center’s Institute for Regenerative Medicine is collaborating with others to 3-D print bones, skin, muscle tissue, cartilage, and kidneys.19 The airline industry has 22,000 parts flying through the skies, printed on 3-D printers. At a commercial scale, 3-D printing enables manufacturers to quickly prototype new designs and build extremely agile production facilities. How will 3-D printing and decentralized manufacturing impact your community’s sales taxes, industrial parks, and employment? 18 Aviva Hope Rutkin, “Report Suggests Nearly Half of U.S. Jobs are Vulnerable to Computerization,” MIT Technology Review, Sept. 12, 2013. 19 Elizabeth Royte, “What Lies Ahead for 3-D Printing?” Smithsonian. May 2013. II. FOUR FORCES AND FORTY-FOUR TRENDS 13 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 27 26 THE NEXT BIG THINGS Global, Digital Currency You’ve heard of bitcoin, right? Bitcoin is a global, digital currency that has several highly desirable features: o It moves from sender to receiver instantly o It is hard to dupe the system due to its cryptography and open, public ledger (called the “blockchain”) o It is cheaper than traditional payment systems because it is exchanged free of a central authority (like a central bank) or middlemen Whether bitcoin survives as the world’s first digital currency or not, the blockchain and related technology has the potential to transform how assets are transferred and fees are collected. The state of Vermont, for example, is undertaking a study to determine if blockchaining could be used for its general ledger20. Banking21 and the music industry22 are also studying applications of the blockchain. Carless Communities Helsinki, Finland conducted research and found that the next generation “no longer considers cars as a distinctive social marker or object of emancipation.” As a result, they’ve set an ambitious goal: to eliminate private cars and create a public, on-demand mobility system by 2025. The system will operate through mobile apps, which will be used to book and pay for any multi-modal trip (bus, train, taxi, bicycle and car-sharing) within Helsinki in one click. While Helsinki’s model may not work for all cities, the trend towards fewer next-geners buying cars is global, and future-ready cities will be prepared to mobilize citizens without private cars. Infrastructure Overhaul Every four years, the American Society for Civil Engineers grades America’s infrastructure, In the 2013 Report Card, they looked at 16 infrastructure categories (see image) and gave an overall grade of D+. America’s infrastructure is failing. 20 Brian Cohen, “Vermont Considering Blockchain Tech for State Records, Smart Contracts,” CoinTelegraph, August 5, 2015: http://cointelegraph.com/ news/115064/vermont-considering-blockchain-tech-for-state-records-smart-contracts, accessed August 30, 2015 21 Heath Terry, Ryan Nash and Jake Siewert, “The Future of Finance,” Goldman Sachs podcast, June 3, 2015: http://www.goldmansachs.com/our-think- ing/podcasts/episodes/7-30-2015-terry-nash.html, accessed August 30, 2015 22 Gideon Gottfriend, “How the Blockchain could disrupt the Music Industry,” Billboard Magazine, August 5, 2015: 14 15 15 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 28 27 II. FOUR FORCES AND FORTY-FOUR TRENDS “The costs of underinvestment in infrastructure are massive. Drivers in the United States annually spend 5.5 billion hours in traffic resulting in costs of $120 billion in fuel and lost time. U.S. businesses pay $27 billion in additional freight costs because of the poor conditions of roads and other surface transportation infrastructure. The electric grid’s low resilience leads to weather related outages that cost the U.S. economy between $18 billion and $33 billion each year, on average. Due to continuing deterioration of water systems throughout the United States, each year there are approximately 240,000 water main breaks resulting in property damage and expensive service interruptions and repairs. “Despite the high costs imposed by insufficient or rundown infrastructure, outlays for both capital investment and operations and maintenance (measured as a percent of GDP) made by all levels of government in transportation and water infrastructure have declined sharply in recent decades. The decline became sharper in recent years, particularly in public spending on drinking and wastewater projects, which declined by 23 percent from 2006 to 2013.” “Expanding Our Nation’s Infrastructure Through Innovative Financing,” U.S. Department of Treasury, Sept. 2014 Test your infrastructure I.Q. with our new report card quiz TRANSIT D ENERGY D+SCHOOLS D PORTS C PUBLIC PARKS C- & RECREATION AVIATION D ROADS D RAIL C+ LEVEES D- INLAND WATERWAYS D-BRIDGES C+ DAMS D WASTEWATER D SOLID WASTE B- HAZARDOUS WASTE D DRINKING WATER D d î b ą ≠± P «ě Ģ h ď Figure 8. INFRASTRUCTURE GRADES A: EXCEPTIONAL B: GOOD C: MEDIOCRE D: POOR F: FAILING Each category was evaluated on the basis of capacity, funding, future need, operation and maintenance, public safety, resillience, and innovation Source: American Society for Civil Engineers, 2013 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 29 28 THE NEXT BIG THINGS This is a global phenomenon. McKinsey estimates that it will cost $57 trillion to build and maintain all the infrastructure needed worldwide through 2030. That is more than the total value of all of today’s infrastructure. What’s more, the price tags for new roads or bridges that are often pitched by legislators to the public include only the cost to build it, not the costs to maintain it. Ongoing Operations and Management (or “O&M”) budgets can cost 50 to 67% of the original cost to build. New Financial Partnerships To fund the world’s infrastructure—and to account for long lead times for planning and construction—new investors including insurers, pension funds, endowments and sovereign wealth funds that are entering the markets23 while PPPs (Public Private Partnership) are aggregating a wider pool of global investors. For example, Denver’s high speed rail included investors from Spain and China and Dallas light rail system is owned by Japanese investors. This underscores other related trends and implications: ⚪Global investment no longer flows primarily from the north (developed countries) to the south. “South-South” investment is becoming the new norm, e.g. India invests in Africa.24 ⚪Many municipalities and states are turning to PPP's and other complex funding mechanisms to build public infrastructure. Unfortunately, these deals, while appearing to avoid tax increases, often end up costing the public more by guaranteeing investor profits far exceeding the cost of traditional tax-exempt financing. Governments often lack the expertise to use these new financial partnerships wisely. ⚪Crowdfunding is being used to fund civic projects. Research shows that local government’s embrace of this platform contributes to its success in serving the common good.25 23 “Infrastructure Financing: A Long and Widning Road.” The Economist. May 22, 2014. 24 Dr. Denis Braun, Executive Director of UNITAID, interview with PSA and Devex, http://www.unitaid.eu/en/resources/press-centre/events/1184- trends-talk-innovative-finance-and-itspromise- for-global-health-2-april-2013 25 Davies, Rodrigo (2015), "Three Provocations for Civic Crowdfunding". Information, Communication and Society, 18 (3). Routledge. DOI: 10.1080/1369118X.2014.989878. 17 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 30 29 II. FOUR FORCES AND FORTY-FOUR TRENDS Microgrids Microgrids are self-contained energy grids that ensure a community has a reliable electric supply when access to their normal supply is disrupted, which could be caused by extreme weather events, physical, and/or cyber attacks. Microgrids ensure that a community has a few buildings that will remain operational no matter what; this gives residents the opportunity to come in for a warm shower, a warm meal, and will allow them to charge their phones and computers. We will see more microgrids in our communities because of four factors: 1 State incentives26 2 Cheap electricity storage 3 The increased likelihood of super storms (see figure below) 4 The increased likelihood of a cyber attack. 26 Collin Sullivan, “NY Awards 83 Grants to Create Community Microgrids,” EnergyWire, July 9, 2015 18 Source: EnergyWire FIGURE 9. TIMELINE OF NATURAL DISASTERS AND STATE MICROGRID INITIATION 10 9 8 7 6 5 4 3 2 1 0Millions of Customer Outages at PeakTEXAS Laws HB 1831 & 4409 support Energy Security and CHP in critical Govt. Infrastructure NEW JERSEY aanounces NJ TransitGrid and Hoboken microgrid project NEW YORK $40 Million prize money for microgrid competition MASSACHUSSETTS $40 Million Municipal Resilience Program CONNECTICUT Microgrid Pilot Program initiated by Public Act 12-148 Hurricane Ike Hurricane Irene Hurricane Sandy December Ice Storm 2008 2009 2010 2011 2012 2013 2014 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 31 30 THE NEXT BIG THINGS Off-Gridding Local communities will generate more of their energy from renewable sources like wind and solar, or natural gas fuel cells. Local communities will also store more of their own electricity. In some locations, there will no longer be a shared electric grid. It is anticipated that for rural locations, it will be cheaper for the utility to install distributed generation (DG) with a storage device than to continue to maintain long distribution lines. Local municipalities will need to address how to ensure that low-income populations continue to have universal access to electricity — this may involve the municipalities subsidizing the installation of DG and storage in low-income households. Electric Vehicles In the near term, we will see more electric vehicles (EVs) in urban areas. In the long term, the entire transportation fleet may switch to electric. It is anticipated that residents will charge their EVs at home at night. Public stations will be used only used to “top off” the battery during the day. Businesses may install charging stations so that employees can charge for free during the day. In addition, EVs will be used as energy storage, which can be called upon to assist the electricity grid when more supply is needed. To put this in perspective, an 85 kWh Tesla battery can store the equivalent of almost three days of power for the average U.S. household.27 The future role of the Electric Utility? Due to distributed generation (DG) in many parts of the U.S., the role of community-owned or public utilities may significantly diminish. And when cost-effective energy storage is available, utilities’ role will be minimized even further. It’s possible that utility companies will try to buy or block cost-effective storage or on-site renewables to maintain viability. 27 Peter Kelly Detwiler, “The Future Promise and Challenge of Applying Used EV Batteries as a Grid Storage Resource,” Forbes, Sept. 26, 2014. 19 20 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 32 31 II. FOUR FORCES AND FORTY-FOUR TRENDS Water Recycling Due to higher temperatures and water insecurity, in 20-50 years we won’t be using drinking water to flush our toi l ets. We’ll be recycling our gray water for use in our gardens and toilets, and flushing only sewage to the local wastewater treatment plant. This will require a change in many state and local plumbing laws28, challenge infrastructure retrofit, pricing dynamics, impact on revenues, changes to water treatment protocols, and re-use/disposal of sludge as a resource.” Desalinization As states and countries look for fresh water, many look to the oceans where 96 percent of our water lies. Currently, about 150 countries rely on “desalinization” to meet their fresh water requirements.29 Until recently, the Middle East and especially Saudi Arabia were the world’s leading technologists (and users), but soon China will surpass the Middle East in the volume of fresh drinking water generated by desalinization. California’s new Carlsbad Desalinization Plant is coming online in 2016 and is gaining a lot of attention. This attention, coupled with the demand for fresh water, will attract new investors and inventors which will eventually drive down the cost. Nanotechnology Nanotechnology is a broad term that covers many areas of science, research and technology. In its most basic form, it means working with things that are small—really small; things so tiny that they can't be seen with a standard microscope. "Everything, when miniaturized to the sub-100-nanometer scale, has new properties, regardless of what it is," says Chad Mirkin, professor of chemistry at Northwestern University. This is what makes nanoparticles the materials of the future. They have strange chemical and physical properties compared to their larger-particle kin. The thing that matters about nanoparticles is their scale.30 28 Grit Leipert, AC Martin and David Summers “First Graywater Recovery System Approved in the City of Los Angeles,” GLUMAC. 29 Faisal Wali, “The future of desalination research in the Middle East,” Nature Middle East, Nov. 26, 2014 30 Rebecca Boyle, “7 Amazing Ways Nanotechnolofy is Changing the World,” Popular Science, November 14, 2012 21 22 23 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 33 32 Nanotech is used in everything from sunscreen to carpet stain resistors to medicine. Scientists working in the field estimate that it could have a transformative effect, not only on what is developed through nanotechnology— the new transformational products—but how we manufacture things. Atomically precise manufacturing, or “APM,” could replace enormous, exhaust-belching factories with cleaner, smaller and more agile supply chains. Think of it as highly precise 3-D printing in a box. Tech-Enabled Health Care Health care is undergoing a transformation. In the future . . . Patients may not have to visit their doctor for routine medical exams; wearable health monitors can share patient data directly with their health care team, and telemedicine delivered by phone or video chat could replace patient exam rooms. Big data, or “bioinformatics” as they're called in health care, will be used to discover more about diseases and effective treatments. Patient health records can be shared between hospitals and emergency response teams, so that when the EMTs get to the patient (who may be unconscious), the EMTs know all the drugs the patient is taking, their health history, allergies, etc. And as a countercurrent, doctors-in-training are being required to learn better bedside manner. Technology can do a lot to improve patient outcomes, but research also shows that caring personnel improve outcomes.31 THE NEXT BIG THINGS 24 31 John M. Kelley, Gordon Kraft-Todd, Lidia Schapira, Joe Kossowsky, Helen Riess, “The Influence of the Patient-Clinician Relationship on Healthcare Outcomes: A Systematic Review and Meta-Analysis of Randomized Controlled Trials,” PLOS. April 9, 2014 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 34 33 Biomimicry “I think the biggest innovations of the 21st century will be at the intersection of biology and technology. A new era is beginning.” – Steve Jobs What can a pile of termites teach us about keeping our government buildings cool during the summer? Turns out, a lot. HVAC systems based on termite mounds are one example of biomimicry, the study of nature to solve human problems. The Eastgate Building in Harare, Zimbabwe was inspired by the natural design of termite mounds. The building has no conventional air conditioning, yet stays regulated year-round, using less than 10% of the energy of a conventional building its size. Local governments are also benefiting from the Lilly Impeller, which circulates municipal water tanks with minimal energy to prevent stagnation. Its design is based on the geometries repeatedly found in nature, which are known to reduce friction and drag. II. FOUR FORCES AND FORTY-FOUR TRENDS 25 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 35 Demographic Trends By Jamie Verbrugge, City Manager, Bloomington, MN Rapid demographic changes are occurring in our communities. The words “rapid” and “demographic change” do not typically occur together. Demographics are often a slow “drip- drip-drip” of change, akin to the story of the frog in the kettle: the water gets hotter and hotter and by the time the frog realizes it’s cooking, it’s too late to jump out. So it is with community demographics: the changes seem so gradual and then all of a sudden we look around and say, “Where did all these people come from?” I had the great fortune to work in a community that was forced – yes, forced – to confront these issues head on. Most people don’t think of Minnesota as undergoing transformation, but Brooklyn Park, Minnesota experienced some of the most rapid demographic change in the country during the two-decade period of 1990-2010. Today, Brooklyn Park is a majority non-white community with more than 20% of its residents being born in a country outside the United States. The wonderful thing about Brooklyn Park’s diversity is its diversity; a cultural panoply more than black and white. It is infused with the richness of the immigrant experience from West Africa, Southeast Asia and Central America. But that richness wasn’t recognized, and certainly not harvested, until we made an intentional effort to do so; a commitment to an “intended future” based on core values that acknowledged every individual’s equal and intrinsic value. Prior to making that commitment, community leaders – elected and appointed – were often befuddled when “best practices” didn’t seem to have lasting impact, if any impact at all. Why? More often than not, we were doing things “to” people and not “with” them. Adjusting to new demographic realities involves relationships, collaboration, and consultation. And in my experience, local government leaders' highest purpose is to serve as the facilitator and connector, to bring “diverse” people together, to find the common core. It is that imperative that compels the Next Big Things. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 36 35 What is the city but the people? - William Shakespeare, Coriolanus There are two massive demographic headwinds impacting our communities: our aging population and our diversifying population. Trends related to these include: Tribalism & Identity Politics “Identity politics” are political arguments that focus on the interests and perspectives of specific groups. These groups can turn into movements or strong voting blocs. Identity politics can deeply wound a community’s sense of social cohesion; they can create an us-versus-them mentality that makes communities less resilient. On the other hand, when citizens feel that they belong, are heard, and represented within their communities, they’re more likely to act in a way that values the commons. As communities become more diverse, their resilience may be tested unless local governments work hard to make all citizens feel included and represented. Structural (Youth) Unemployment Due in part to the global talent pool (Trend 35 ) and the deep investments made worldwide to automate our factory floors and our lives (See Trend 12, “Unmanning”) we could be facing a 20-year period of structural unemployment. Larry Summers writes in the 2015 Global Economic Outlook: “If we look at the data on workers aged 25-54—the group we think of as the backbone of the workforce—the percentage of those who are not working has risen by a factor of more than three times over the course of my lifetime. If current trends continue it could well be that a generation from now a quarter of the middle-aged demographic will be out of work at any given moment.” II. FOUR FORCES AND FORTY-FOUR TRENDS 26 27 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 37 36 Civil Rights Spring The Arab Spring. The Black Spring. Paul Mason, Economics Editor for The Guardian, argues that at the heart of the social protests around the world is “the graduate without a future.” This ties to Trend 27: Structural Youth Employment, and gets at something deeper. In Arab Spring Dreams, authors Nasser Weddady and Sohrab Ahmari give voice to the next generation, the group that sparked the Arab Spring. Although the anthology includes many different viewpoints, the book’s major theme is timeless and ties well to America’s Black Spring: a young generation aching for a better future, a future where civil rights, women’s rights, religious freedom and basic human dignity are upheld by their governments, who rule wisely and control police militarization. Until that “better future” comes into view, expect youth-led revolts and uprisings like Occupy Wall Street or student protests like those in Quebec. THE NEXT BIG THINGS Unmet expectations social media+= a potent mobilizing force. 28 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 38 37 Mass Migration Whether due to conflict, climate change, natural disasters, or the desire to earn more, migration will continue to create dynamic population shifts for many communities. This trend may impact property or income taxes, and the costs of providing services. Mass migration can have a destabilizing force on both the community that’s losing citizens and the one gaining citizens. Handled well, in-migration can also strengthen and revitalize communities. A community’s approach is critical. In the United States by 2060 it’s estimated that 18% of the population will be foreign- born as the chart shows. II. FOUR FORCES AND FORTY-FOUR TRENDS 29 25% 20 15 10 5 0 — % of the population that is foreign born Note: 'Foreign-born' are those born outside the United States and U.S. territories Source: U.S. Census Bureau, "Historical Census Statistics on the Foreign-Born Population of the United States: 1850-2000" and 2014 population projections Source: Pew Research Center Figure 10. Foreign-Born Share of U.S. Population 1850 1900 1970 2015 2060 ● ● ● ● ● Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 39 38 Middle Class Map The global map of the middle class will continue to change in the next 20 years, affecting local governments in direct and indirect ways. Overall, North America and Europe’s share of the middle class will decrease to 7% by 2030, while Asia-Pacific’s share will drastically increase from 28% in 2009 to 66% in 2030. According to the Brookings Institution: “. . . By 2015, for the first time in 300 hundred years, the number of Asian middle class consumers will equal the number in Europe and North America. By 2021, on present trends, there could be more than 2 billion Asians in middle class households. In China alone, there could be over 670 million middle class consumers, compared with only perhaps 150 million today.”32 The local government impacts of the middle class have been well documented. Public health researchers Richard G. Wilkinson and Kate Pickett have demonstrated that a larger middle class and greater income equality is correlated to better health and social outcomes including lower rates of drug abuse, higher rates of education, lower rates of imprisonment, and greater social mobility. THE NEXT BIG THINGS 32 Homi Kharas and Geoffrey Gertz, “The New Global Middle Class: A Cross-Over from West to East” from China’s Emerging Middle Class: Beyond Economic Transformation” (Cheng Li, editor), Washington, DC: Brookings Institution Press, 2010 30 2009 2020 2030 North America 338 18% 333 10% 322 7% Europe 664 36% 703 22% 680 14% Central and South America 181 10% 251 8% 313 6% Asia Pacific 525 28% 1,740 54% 3,228 66% Sub-Saharan Africa 32 2% 57 2% 107 2% Central and South America 105 6% 165 5% 234 5% Asia Pacific 1,845 100% 3,249 100% 4,884 100% Chart 1. Size of the Middle Class by Region (millions of people and global share) Source: Brookings Institution Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 40 2000 1600 1200 800 400 0 1950 1975 2000 2025 2050 Figure 11. Population Aged 60 or Over MillionsWorld More developed regions Less developed regions 39 Elder Expense Many countries are facing a “Baby Boomer bulge,” when the share of citizens over age 65 begins to increase. This puts immediate and direct pressure on local governments, which are expected to pay pension benefits to retiring public employees. It also puts pressure on national and state budgets. In the U.S. for example, if there are no significant changes to entitlement spending (Social Security, Medicare and Medicaid), it will consume all of the federal budget by 2030.33 This could create a serious financial hardship for communities, especially if they face decreasing revenues. (See trend 44 Fiscal Uncertainty). But there’s another issue at play: the retirement age. When social security was invented in the U.S., there were 14 employees supporting every retiree. Back then, people lived for a few years post-retirement, so the total amount of benefits paid was manageable. Fast forward to today when there are only two workers in the U.S. supporting every retiree…and retirees live longer. It adds up. The expense of supporting a large, retired population could spell generational conflict, more dramatic changes to retirement ages, and/or restructuring of entitlements. II. FOUR FORCES AND FORTY-FOUR TRENDS 33 Sean Gorman, Will Entitlement Programs and Debt Consume U.S. Budget in 2025?” Politifact. April 23, 2012. 31 Figure 11: Source: United Nation, World Population Ageing 1950-2050 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 41 40 The Potential Support Ratio (“PSR”) is the ratio of people aged 15-64 years old per one older person aged 65 years or over. When Social Security was invented after the Great Depression, there were 14 workers supporting every retiree. The global PSR will fall from its current ratio of 9:1 (nine workers supporting one retiree) to 4:1 (four workers supporting one retiree) by 2050. The ratio is worse in developed countries, and they will have less time to adjust.34 Taken together, the increasing costs of supporting an elderly population and the decrease in the number of working-age people to support them may spell generational conflict or a restructuring of entitlements. Urbanization: Mega & Mid-Sized THE NEXT BIG THINGS 34 Ibid 35 Daniel Runde, “Urbanization, Opportunity and Development,” Center for Strategic and International Studies, January 6, 2015. 32 Figure 12. Growth in Urbanization 40% Rural * Dataset comprises urban agglomerations with 300,000 inhabitants or more in 2014. Data are for countries existing in 2014, mapped on modern borders. Projections from 2014 Source: The Economist 23.0% Other urban Fewer than 300,000 GLOBAL CITY POPULATIONS* 1950 1960 1970 1980 1990 2000 2010 2020 2030 3.8% Smallest cities 300,000 to 500,000 6.1% Small cities 500,000 to M 13.4% Medium cities 1M to 5M 5.2% Large cities 5M to 10M 8.6% Megacities 10M or more New Orleans United States 1.0 Million 1.0 0.8 0.6 0.4 0.2 0.0 1950 2000 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 42 41 Rapid urbanization is at a crossroads; it will either result in greater economic prosperity or greater unrest.35 Areas to watch for the prosperity/unrest drama include the mega-cities (over 10 M people) primarily in Asia and India. But urbanization’s opportunities aren’t limited to mega-cities. In developed countries, the rise of “medium cities,” especially those between one and two million people, will outpace the growth of larger urban centers, both in population growth and economic impact. Already in the U.S., mid-sized cities account for more than 70% of GDP.36 This growth in mid-sized cities could cause greater fragmentation among already fragmented municipalities, at the same time as greater collaboration is needed to address environmental, transportation and economic development issues. Rural v. Urban As more people move to cities, a rural versus urban split may widen. As a response, politicians may adopt a “cities-are-the-enemy” approach to running for office and governing. Social scientist Katherine J. Cramer asks, “How do (rural) people perceive their economic interests and how do they connect these to policy and candidates?” After extensive research, Cramer found that there is a “rural consciousness.” She describes it in her book Understanding the Politics of Resentment: “Many people in rural areas see themselves as rural people who live in a place that is routinely ignored by decision makers and the distribution of resources. In addition, they often see themselves as fundamentally different from urbanites in term of values and lifestyles. This results is an understanding of politics in which government (and public employees) are the product of anti-rural forces and therefore should be scaled back as much as possible.” II. FOUR FORCES AND FORTY-FOUR TRENDS 36 Mathieu Lefevre, “The Mighty Metropolis,” The World Today, February & March 2015. 33 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 43 42 Smart Citizens As this project hit the press, many people understood “Smart Cities” as technology- and sensor-driven, the hardware that enables a city to collect and use data. But the software—the people side of cities— is just as important. “Smart Citizens” — those who can engage with technology to make their daily lives more convenient or to make their cities better—are now a focus for many progressive communities. For example, Sweden’s “Smart Citizens” initiative puts citizens, technology and services together in a way that enables citizens to be more literate about city services, and more able to help solve problems. It’s a proactive way to give citizens control of the “internet of things” in a way that makes cities and their experience of them more humane and interactive. THE NEXT BIG THINGS 34 The map above is a screen shot that shows the number and locations of sensors that citizens have self-registered as of the date of this report. By sharing their devices and locations, citizens are opting-in to be alerted to important Helsinki news, and even, in the case of emergency, be called upon to help. Figure 13. Map of Registered Devices Source: Sweden’s Smart Citizens project Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 44 43 II. FOUR FORCES AND FORTY-FOUR TRENDS Nomadic Workforce Dubai’s population includes only five percent naturalized citizens. The majority of its residents are expatriates from other countries. Dubai is working hard to become the kind of place that the world’s smartest and most creative people want to live and work. As the global talent pool becomes more educated and jobs become more digital, some communities and countries are aggressively positioning themselves to attract this highly skilled, nomadic workforce. This “attract talent, not companies” strategy will require communities to rethink ideas like “citizenship” and “economic development”. Communities and countries that want to attract and keep a nomadic workforce will recruit globally. China and India will produce half of the world’s educated labor pool by 2030 as Figure 14 demonstrates. 35 Figure 14. Global Talent Pool in 2030 Projected share of 25-34 year-olds with tertiary degree across OECD and G20 countries Positive trend Negative trend China India United States Brazil Indonesia Russian Federation Saudi Arabia Japan Mexico Argentina Turkey United Kingdom Korea Germany France Canada Poland Australia Spain Italy Others 27% 23% 8% 5% 5% 4% 3% 3% 2% 2% 2% 2% 2% 2% 1% 1% 1% 1% 1% 1% 6%Source: OECD Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 45 44 THE NEXT BIG THINGS Local governments face a unique iteration of the mobile, nomadic workforce: Shorter employee tenure and greater turnover, especially among young talent who are unwilling to trade their entire careers for local governments’ increasingly meager offerings. Becoming an “employer of choice” will be a challenge as city and county governments compete with nonprofits and the private sector. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 46 45 Hyper-localization As a response to globalization, some communities are going hyper-local, inventing their own local currencies37, creating time banks38, creating their own hyper-local media sites39, and getting off the grid. Some examples include Ithaca, New York, which created its own currency. Ithaca dollars can be exchanged locally and are accepted at many local retailers. And in Madison, Wisconsin, over 2,500 residents trade services without exchanging money through the Dane County Time Bank. Every hour invested helping someone else is an hour members can extract for a service or good they want. II. FOUR FORCES AND FORTY-FOUR TRENDS 37 People Powered Money, http://b.3cdn.net/nefoundation/0dba46d13aa81f0fe3_zhm62ipns.pdf 38 http://timebanks.org/what-is-timebanking 39 See the Columbia Journalism Review’s list of communities’ hyper-local sites: http://www.cjr.org/news_startups_guide/online-news-websites/coverage/ hyperlocal-news.php. 36 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 47 Governance Trends Robert J. O’Neill Jr., Executive Director, ICMA The International City/County Management Association (ICMA) recently celebrated our 100th anniversary. Now, we look to the next 100 years and consider what role local government will play; what will be the big ideas that will transform our communities into even better places to live, work, and play? In the future, one thing won’t change. Good government will continue to operate nearly invisibly to citizens, tackling the work that citizens can’t do for themselves. When residents enjoy their parks, turn on their taps, drive over paved roads, and set out their garbage or recycling, they’re benefiting from local government that works. But behind the scenes, a lot will change. For starters, federal and state budgets continue to be cut. This means that services that were once provided elsewhere will fall to local governments to sort out. City managers and elected officials will need to deliberate: what is important for our community? What should local government do? Who must we partner with? How do we pay for the services provided? And we will have to innovate to be successful. During the recession, we saw local government outsource services and re-engineer others. In the next twenty years, we’ll see local governments use more and more innovative approaches to address their communities’ challenges. They’ll work more collaboratively with other cities and counties, to further leverage economies of scale. You’ll see more partnerships between government, nonprofits, and the private sector. Because as our challenges get more complex, we need more nuanced responses, beyond the traditional boundaries of local government. To meet the challenges, local governments will attract a new generation of workers who are motivated to take a fresh, bold look at how local governments run. We need their kind of thinking, and we need to make room for them. But the fact is, the next generation won’t be attracted by inflexible organizations and rigid structures. There is no such thing as job security in local government right now, and pay and benefits have been cut or frozen in many communities. So we’ll need to attract and engage the next generation by emphasizing our original charter: to do meaningful work that enhances the lives of citizens. And if we can also arm them with great technology, cutting-edge initiatives and training, and professional development, all the better. I believe good government is important. And I believe that the next twenty years will be a period for local government to shine. The public is with us; trust in local government is at nearly record highs. If we can maintain the public trust through ethical behavior, transparency, engagement, performance, and accountability while also working with new partners on new initiatives, we’ll be able to look back from 2036 and say, “We tackled the Next Big Things.” THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 48 47 Declining Federal Government Effectiveness “The main political challenge of the next decade will be fixing government.” – John Micklewait and Adrian Wooldridge, The Fourth Revolution The “layer cake” of government that most current city and county administrators grew up in—where the federal government has the money, states have the power, and cities have the problems—has been cut into pieces. In the developed world, national governments have less money or are going broke, many states and provinces have become ideological battlegrounds, and cities…well, cities still have problems. (But the local level also holds the greatest promise, See Trend 38: Trust in Government). Have federal governments and their international alliances overrun their effectiveness, i.e. will the EU hold together, do organizations like the G20 matter, will the partisanship that has Washington, D.C. in gridlock remain? While national governments continue to work mightily to solve the world’s most pressing problems, their relevance continues to decrease. National governments are “failing” in the eyes of their citizens, who see them as remote and removed. Or as one city manager explained, “Nations don’t have residents. Cities do.” Another indicator that federal governments are losing relevance compared to their local counterparts: international growth companies are abandoning country strategies and implementing city strategies instead. II. FOUR FORCES AND FORTY-FOUR TRENDS 37 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 49 48 Trust in Government Trust in the national government is at an all-time low in the United States. Public Trust in Government: 1958-2014, Pew Research Center THE NEXT BIG THINGS 38 Figure 15. Trust in U.S. Government 1960Eisenhower NixonG.H.W. BushG. W. BushFordReaganKennedyJohnsonCarterClintonObama0 50 100 1970 1980 1990 2000 2010 Source: Pew Research Center Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 50 How did we get here? Messages from the Executive branch may help explain it: “Government cannot solve our problems, it cannot set our goals, it cannot define our vision. Government cannot eliminate poverty or provide a bountiful economy or reduce inflation or save our cities or cure illiteracy or provide energy. And government cannot mandate goodness.” -Jimmy Carter, State of the Union Address, 1978 "Government is not the solution to our problem; government is the problem." -Ronald Reagan, Inaugural Address, 1981 “The era of big government is over.” -Bill Clinton, State of the Union Address, 1995 "Change doesn't come from Washington. Change comes to Washington." -Barack Obama, DNC speech, 2008 “I trust people; I don’t trust the federal government.” -George W. Bush, Presidential debate v. Al Gore, 2000 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 51 50 At the same time, trust in local and state governments are holding near average. Trust in local government creates a competitive advantage for those local governments with the vision and ambition to reinvent and become more relevant to citizens. Research shows that trust between citizens and their government is an important and independent predictor of support for government policies, more important than partisanship or ideology alone.40 To maintain the public’s trust, future-ready communities must pay close attention to political trust and social trust, which operate together and seem to be mutually reinforcing: THE NEXT BIG THINGS 40 Peri K. Blind, “Building Trust in Government in the Twenty-First Century, presented in Vienna Austria, 2007. 41 Ibid. Social trust *** refers to citizens’ confidence in each other. Communities with greater social trust have more cohesion and are more resilient. (See Trends 26, 28, 29, and 31 for key trends related to social trust.) Political trust ★★★ transcends partisanship; it “happens when citizens appraise the government and its institutions, policy-making in general and/or the individual political leaders as promise- keeping, efficient, fair and honest.”41 Political trust depends on legitimate policy-making. Figure 16. Trust in State and Local Government Source: Gallup 80 70 60 50 40 30 20 71 62 51 67 53 68 69 68 70 69 6363 1973 1977 1981 1985 1989 1993 1997 2001 2005 2009 2013 Figures are percentages with a great deal/fair amount of trust in the level of government Local State Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 52 51 City-to-City Collaboration In the absence of leadership at the national or state levels, local governments are taking matters into their own hands, e.g. the Mayor of London announced the “London, England Visa” program, which would enable the City to authorize Visas for the brightest and best, part of a talent strategy that works around Members of Parliament and the national government. City leaders are also increasingly forming their own global or regional coalitions to address their most pressing issues, e.g. the C40 includes forty of the world’s largest cities committed to mitigating climate change. They tackle joint research projects, share best practices, and have committed to each other to reduce carbon emissions. These types of issue-based, city-to-city collaborative networks are already reaping rewards for members and may supplant traditional professional state or national associations. “I talk more with the mayor's office in Barcelona than I do with my own state and national representatives.” — Jim Keene, City Manager of Palo Alto, California. VUCA Leadership A common term used when training military leaders is “VUCA,” an acronym for Volatile, Uncertain, Chaotic and Ambiguous. This is precisely the environment that local government leaders are inheriting as tax revenues fall, staff retire or leave early, citizens’ expectations increase, and more of the “problems” in society fall to local governments to solve. This VUCA environment is not likely to diminish soon, and local leaders can either bury their heads and try to continue to make things work, or they can embrace this opportunity to reinvent local government. Nathan Bennett and G. James Lemoine suggest that each of the four conditions in VUCA require their own, appropriate response. II. FOUR FORCES AND FORTY-FOUR TRENDS 39 40 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 53 52 The following chart, although designed for corporations, offers some insight about how leaders in any domain can approach complexity, volatility, ambiguity and uncertainty, based on how much is known about a situation and how well you can predict the results of your actions44: THE NEXT BIG THINGS 44 Nathan Bennett and G. James Lemoine, “What VUCA Really Means for You,” Harvard Business Review, January-February 2014. complexity Characteristics: The situation hasmany interconnected parts and variables. Some information is available or can be predicted, but the volume or nature of it can be overwhelming to process. Example: You are doing business in many countries, all with unique refulatory evvironments, tariffs, and cultural values. Approach: Restructure, bring on ordevelop specialists, and build up resources adequate to address the complexity. ambiguity Characteristics: Casual relationships are completely unclear. No precedents exist; you face "unknown unknowns." Example: You decide to move intoimmature or emerging markets or to launch products outside your core competencies Approach: Experiement. Understanding cause and effect requires generating hypothesis and testing them. Design your experiments so that lessons learned can be broadly applied. volatility Characteristics: The challenge isunexpected or unstable and may be of unknown duration, but it's not necessarily hard to understand; knowledge about it is often available. Example: Prices fluctuate after a natural disaster takes a supplier off-line. Approach: Build in slack and devote resources to preparedness— for instance, stockpile inventory or overbuy talent. These steps are typically expensive; your investment should match the risk. uncertainty Characteristics: Despite a lack of other information, the event's basic cause and effect are unknown. Change is possible but not a given Example: A competitor's pending product launch muddies the future of the business and the market. Approach: Invest in information - collect, interpret, and share it. This works best in conjunction with structural changes, such as adding information analysis networks, that can reduce ongoing uncertainty.-HOW WELL CAN YOU PREDICT THE RESULTS OF YOUR ACTIONS? +-HOW MUCH DO YOU KNOW ABOUT THE SITUATION?+ Figure 17. How Leaders In Any Domain Can Approach Complexity, Volatility, Ambiguity And Uncertainty Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 54 53 The Delphi panel that advised The Next Big Things was exceedingly mindful of this VUCA environment and identified several areas where greater leadership from local government could make a large, long-term difference in the lives of citizens. These include: Design a 50-year plan for the community. Fifty-year time horizons are appropriate for some of the greatest challenges to our communities. They also allow us to amortize costs over a longer time frame, and shift the conversation from “How will this impact me?” to “How will this impact my grandchildren?” It may also mitigate “NIMTO” (Not in my term in office) thinking among electeds. Embracing innovation and instilling an innovation mind-set among staff, thereby reframing the culture of government from a culture of compliance to a culture of innovation. Intentionally minding “the gap” between the political will for change and municipal government’s ability to administer it.45 A critical challenge for local government leaders is to recruit and retain qualified leaders at every level. Research shows that in the U.S., Caucasian administrators are out of touch with the levels of satisfaction among African Americans. Specifically, Caucasian administers estimate that African Americans are satisfied with government services, while African Americans report dissatisfaction.46 II. FOUR FORCES AND FORTY-FOUR TRENDS 45 John Nalbandian at the University of Kansas has written extensively about this: https://webapps.icma.org/conference_Handouts/handouts2014/ Nalbandian-Political%20Astuteness.pdf 46 Mark D. Adbury and J. Edward Kellough, “Representative Bureaucracy,” Journal of Public Administration and Research, November, 2007. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 55 54 Citizen Engagement How do you engage citizens in rich discussions that have long-term importance to the community? Over the next twenty years, next-generation citizens will become the majority of our citizens. They don’t “show up” to place-based events in traditional ways. Citizen engagement—how it’s planned, executed, incorporated and measured— will be key. Innovations are being tested in local governments around the world and cities are sharing their best practices widely. Future-ready communities will experiment with a broad range of citizen engagement techniques. Direct Democracy In the age of social media and real time digital communication, some residents are calling for more direct democracy. In the U.S., the use of ballot initiatives is a traditional form of direct democracy, but the development of new technologies has expanded the possibilities. Experiments with participatory budgeting, for example, have blossomed from cities in Brazil, to countries around the world. In the U.S., this has included Chicago, New York, Boston, San Francisco, St. Louis, and Vallejo and Long Beach, CA According to Karen Mossberger and Yonghong Wu, technology can make it easier to create conditions for direct democracy – providing information and participatory opportunities, including the use of social media or online town halls to discuss issues, and platforms to rank or rate ideas, which have been used by some cities in their budgeting processes. THE NEXT BIG THINGS 41 42 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 56 $1,100M $880M $660M $440M $220M $0 1990 1992 1994 1996 1998 2000 2002 2004 2006 2008 2010 2012 2014Total (in millions)55 Corporate and Special Interest Influence “There are two things that are important in politics. The first thing is money, and I can’t remember what the second one is.” — Mark Hanna, 19th Century Industrialist and US Senator In January 2010 the Supreme Court issued Citizens United, which allows companies and unions to make unlimited contributions to pay for political ads and other election tools. Since then, concerns about the ruling’s impact on public policy began to escalate. More money is now flowing into elections as the following chart shows. II. FOUR FORCES AND FORTY-FOUR TRENDS 43 Source: The Sunlight Foundation Figure 18. All Money Flowing Into Elections Independent Expenditures Communication Costs Electioneering Communications Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 57 56 And there is at least a corollary connection between corporate political donation and payoffs. The Sunlight Foundation reports: “After examining 14 million records, including data on campaign contributions, lobbying expenditures, federal budget allocations and spending, we found that, on average, for every dollar spent on influencing politics, the nation’s most politically active corporations received $760 from the government. The $4.4 trillion total represents two-thirds of the $6.5 trillion that individual taxpayers paid into the federal treasury. “Of the 200 corporations we examined, we could sum the financial rewards for 179. Of those, 138 received more from the federal government than they spent on politics, 102 of them received more than 10 times what they spent on politics, and 29 received 1,000 times or more from the federal government than they invested in lobbyists or contributed to political committees via their employees, their family members and their PACs.” The results aren’t limited to the federal level. Of the 200 largest corporate donors, state and local governments awarded subsidies to 174 (87%) of them, according to Good Jobs First, an organization that tracks economic development programs. And there’s another mitigating factor: redistricting. Many argue that redistricting allows incumbents to choose their voters, further entrenching political interests, and the corporate and special interests they represent. Is your community ready to handle more corporate contributions in a way that maintains the public trust (Trend 38)? THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 58 57 Fiscal Uncertainty As nations and states transfer more responsibilities to local governments, we have the challenge of “too little money chasing too many needs.” The U.S. Government Accountability Office (GAO) predicts that, “at current rates total tax revenues for the (state and local government) sector would not return to the 2007 historical high until 2058.”47 II. FOUR FORCES AND FORTY-FOUR TRENDS 47 State and Local Governments’ Fiscal Outlook, 2014 Update, Government Accountability Office. 44 Figure 19. Simulated State and Local Operating Balance, as a Percentage of GDP Source: Government Accountability Office Percentage of GDP 6 4 2 0 -2 -4 -6 2005 2010 2015 2020 2025 2030 2035 2040 2045 2050 2055 2012 2060 Operating Balance Projection begins Positive Balance Negative Balance YEAR Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 59 58 Some local governments in the United States are overwhelmed by debt. Nine cities, towns and counties (in red on the map below) have filed for Chapter 9 bankruptcy since January 2010. The cities in black indicate utility authorities or other municipalities. The two primary drivers of local governments expenses are pensions and health care costs. State and local Medicaid expenditures and the cost of health care compensation for state and local government employees and retirees generally grow at a rate that exceeds GDP, which runs local budgets deeper and deeper into trouble. Many cities and counties rely on their state governments to grant them authority to address their local fiscal uncertainty. States must therefore be responsive to their communities’ needs and avoid a one-size-fits-all solution. THE NEXT BIG THINGS Figure 20. Municipal Bankruptcies Map Source: Mike Maciag, Governing Magazine United States of America Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 60 59 The GAO estimates that: “. . .closing the fiscal gap would require action to be taken today and maintained for each year equivalent to an 18 percent reduction in the state and local government sector’s current expenditures. Closing the fiscal gap through revenue increases would require action of similar magnitude through increases in state and local tax revenues. More likely, closing the fiscal gap would involve some combination of both expenditure reductions and revenue increases.” II. FOUR FORCES AND FORTY-FOUR TRENDS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 61 III. FOUR FUTURE SCENARIOS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 62 61 III. FOUR FUTURE SCENARIOS In the previous section, we shared forty-four trends that could impact your community. By sorting them based on their certainty and impact, in The Big Sort activity (See Section V), you see where your community’s vulnerabilities are, and where you might need to focus. But what will the future really be for your community? Truth is, there is not one, single future for your community. Your community will be impacted by multiple external events that are beyond your control —like a hurricane or a decision by a major employer to bring thousands of new jobs to your community. We call these “outside-in” events, because they start outside your control and impact your community. Your community will also be impacted “inside-out”— by the decisions and actions your community takes, or doesn’t take, that will impact its future. For example, take the issue of cars. Will we continue to drive our own cars, or have driverless cars? Will our cars be self-owned, or shared assets? This map points to four possible futures. Any of them, or a combination, could exist in the future. Public policy can nudge these futures (outside-in) but human choice (inside-out) should also be considered: Source: Morgan Stanley (2015) with minor modifications www.driverless-future.com ▼ ▲ ◄► (1)Today ⚪100 year old model ⚪OEMs, Suppliers, Rentals (3)Owned Autonomy ⚪High tech, individually operated ⚪Tesla, MobilEye, Daimler F015 (4)Shared Autonomy ⚪High tech, individually operated ⚪Tesla, MobilEye, Daimler F015 (2)Shared Economy ⚪Low tech shared asset ⚪Uber, Lyft, Car2Go etc Asset Owned Asset Shared Human DriverAutonomousSpecial Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 63 62 THE NEXT BIG THINGS SCENARIO ONE: THE OFFICIAL FUTURE It assumes that local government, the electorate, electeds and trends will continue on their current trajectories. The largest impacts come from increased population (in-migration from the South where water is scarce), 3D printing and robotics, which both shrink the traditional workforce, but also cause new cottage industries to spring up, and the eventual death of Baby Boomers, which drives down the population, but also drives up city revenues, because the city no longer has to pay retiree Boomer pensions or health care. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 64 63 SCENARIO TWO: NOMENTUM Nomentum is the story of Laurel County, which won the 2016 award for “Most Innovative Community” due to its progressive government, embrace of technology, and high citizen engagement. After its award, Laurel County attracts lots of young families and new companies. Unfortunately, Laurel continues to tout its “best place to live” credentials long after its “innovative” reputation runs dry. Laurel fails to see the signs that global competition is impacting its major employers, and withdraws major technology investments after one failed implementation attempt for a core system. “It’s better to be safe than sorry” is the mantra of the County Supervisor. As their employers downsize and quality of life diminishes by 2026, a group of “Boomerang” residents (folks who moved away to finish college, but returned in the wave of in-migrants after the 2016 award) band together and start to raise hell. The story ends in 2036 when the county supervisor faces a run off election with one of the Boomerangers, a young woman who is supported by many of the community’s most progressive citizens, and promises that Laurel can re-earn its “innovative” reputation. 2016 Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 65 64 WE’RE NOT GONNA TA K E IT This scenario builds on the income and class disparities affecting so many of our communities. . . and then a natural disaster hits, affecting the “have” and “have not” parts of town very differently. The disaster highlights the inequities within the community and results in a lawsuit brought against the city by disenfranchised citizens. The lawsuit is settled in the residents’ favor and as part of the settlement, the City must agree to more inclusive processes and more equitable services. At the same time, a new City Manager is hired, who grew up in the city and is committed to making changes. He takes major steps to ensure the city is equitable for all. “We’re Not Gonna Take It” shows how the next generation may help resolve our communities’ most divisive issues. THE NEXT BIG THINGS SCENARIO THREE: Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 66 65 This is the most tech-enriched future. It tells the story of autonomous vehicles, tech-driven education, the fragility of our electric and telecommunications network, and the possibilities of privatization. The climax of the story occurs when citizens realize how much impact corporations have on education and “public” services; citizens revolt in protest, throw out all of their elected councilwomen and men and transform to a high-tech direct democracy. Direct democracy is fun for awhile; citizens receive alerts on their tablets and smart phones to vote on key municipal decisions. And initially, participation is high and many other cities copy this model. But eventually, decision fatigue sets in and citizens wonder if direct democracy, although possible, is worth it.DEMOCRACY V.3.0Will any of these scenarios come completely true? Probably not. But elements of these scenarios may come true in many communities, including yours. The purpose of building scenarios based on trends is to see how things could play out over time, and where the pitfalls and opportunities are. SCENARIO FOUR: Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 67 IV. PUTTING IT TO WORK Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 68 67 If you’re here, you’re committed to making change happen. We’ve sorted the following suggestions into Basic, Intermediate, and Transformative solutions to address The Next Big Things. Basic Solutions 1. Determine your community’s resource threats and opportunities Resources are most closely tied to human existence and are therefore the most important to your community. As you review the Resource Force Trends 1-6: o Which Resource trends will have the greatest impact on your community? Will the affect be positive or negative? o How is your community responding to these trends? o What else is needed? By whom? By when? o If your community will be impacted by these trends but has not responded to them, have you designed a likely scenario for your community and shared it with your electeds and community leaders? o If you already have responses to these trends, how can you extend or strengthen your response? For example, if you have a climate change plan, how can you broaden its impact, e.g. requiring departments to adopt climate change plans; requiring vendors to have climate change plans; setting more ambitious targets; etc. 2. After Resources, what are your next areas of greatest vulnerability? Considering the other three of the Four Forces— Technology, Demographics, and Governance—where is your community most vulnerable? o Does your community have plans or scenarios to address these vulnerabilities? If not, why not? IV. PUTTING IT TO WORK Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 69 68 o What other information do you need to know, to develop responsible plans in any of these areas? o Who else needs to be involved? How can they help? 3.Invest in leadership development – for electeds and staff Local governments are facing a series of unprecedented changes, from frail budgets to climate change. We can’t assume that ordinary citizens who get elected will be well equipped to handle these new realities, or the disruptive changes that may come. Future-ready communities should invest in training their electeds on the most important issues facing the community, and in processes related to VUCA leadership. In Austin, TX the new city council went through several months of “deep dive” trainings on a series of topics that the Mayor and City Manager deemed as critical. Whenever possible, staff should be included in these trainings and trainings should be the highest quality possible. 4.Collective Procurement To handle revenues carefully, many communities already coordinate their purchasing through a central purchasing department or work through a consortium like the UK’s Local Government Procurement Network or the United States’ US Communities Consortium. o How can this be extended to other areas like information technology, maintenance, and professional development, to scale savings event further? 5.Strengthen community networks The RAND Institute has shown that resilient communities are those that have multiple ties between individuals, public, private, nonprofit and civic sectors. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 70 69 When disaster strikes, local governments that have high-trust relationships with organizations outside the bureaucracy rebound the most quickly and completely. o Map your networks. What formal and informal community networks and relationships do you have? How strong are these connections? Are they strong enough to handle a community disruption? o What connections are needed? How could you develop, expand and enhance them? 6. Be a place for all people As we saw in the Demographics section (Trends 26-35), communities can be torn apart by factions and tribes, which decrease social trust and trust in government (Trend 37 ). To address this potentially destabilizing force, local governments must intentionally work to be a place for all people. Some ideas to get you started: o Provide “Bias Awareness” training for all employees, to help them understand their unconscious bias and how to address it; o Make connections and specifically invite taskforce members or community volunteers who are not “the usual suspects,” i.e. young professionals, Hispanic Chamber of Commerce, Urban League, senior coalitions, nonprofit leaders, etc. o Increase your community engagement. Chattanooga, Tennessee set a goal to engage one million people in its regional future. It wasn’t just about soliciting input; engaging the public actually changed the tone of the community and the relationship between the public sector and its residents.48 IV. PUTTING IT TO WORK 48 Read more: http://www.governing.com/cityaccelerator/blog/4-important-lessons-from-40-years-of-civicengagement.html Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 71 70 Inte rmediate Solutions 7.Interdisciplinary, Innovative Local Government When Woodrow Wilson wrote his seminal 1887 essay “The Study of Administration,” cities and counties were smaller and more homogenous, the middle class was larger (there were fewer disparities), and issues were less complex, Wilson’s siloed and specialized administration regime made sense in the 1880s. But it is inadequate today. Today’s issues, like the declining middle class, can’t be solved in a single department. Does it belong in “economic development,” “workforce development” or should it be shuffled to the Department of Education? Future-ready cities are taking two approaches to tackling their communities’ thorniest issues: o Innovation Teams. Cities like Decatur, Georgia and Palo Alto, California are using Innovation Teams to break down departmental silos and use interdisciplinary groups to address some of their communities’ most vexing challenges.49 o Convening broad community stakeholders to address cross- community issues. For example, in Fort Lauderdale, Florida, the city is working with a consortium of governments to assemble transportation stakeholders and identify “first principles” for a regional transportation plan. 8. Broaden your definition of Sustainability Can a community be considered truly “sustainable” when its middle class has shrunk by half and most households are not earning a living wage? What if its fastest growing demographic groups are not receiving adequate education? THE NEXT BIG THINGS 49 Learn more about the Alliance for Innovation’s Innovation Academy: http://transformgov.org/en/learning/innovation_academy Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 72 71 These questions are at the heart of a global movement to broaden the definition of sustainability beyond the traditional environmental components to include economic and social justice factors. o Does your community have a scorecard to report on its environmental, social, and economic sustainability goals? o Is your community working in consortium with other communities to share best practices and deepen its sustainability outcomes? 9. Develop contingency plans for both rapid growth and rapid decline There is not one, single future for your community. Population in your community can change due to natural disaster, climate change, or economic opportunity. Future- ready communities have contingency plans in place. Facilities like Arizona State University’s Decision Theater are wonderful resources to help you envision the real world impacts of significant shifts in population.50 The benefit of doing contingency plans is that it shows the strength or weakness in existing systems, and enables you to “practice” with a new possibility. 10. Balance the community’s focus on growth with quality of life To attract and keep citizens, communities must be inclusive and have the assets and amenities residents enjoy. And as technology advances, the mobile, nomadic workforce (Trend 35 ) will be able to work anywhere. What will make them choose your community? Perhaps what the “Nomentum” scenario teaches us more than anything is that quality of life isn’t accomplished one year, and then completed. Quality of life requires ongoing maintenance, and even measurement. How does your community measure quality of life? 51 IV. PUTTING IT TO WORK 50 Learn more about Decision Theater: https://dt.asu.edu/ 51 NEXT Generation Consulting offers a free quality of life measurement and visual: http://www.nextgenerationconsulting.com/how-to-measure-quality-of-life/ Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 73 72 THE NEXT BIG THINGS Tran sformative Solutions 11. The Fifty-Year Plan Development of a 50-year plan would help local governments achieve their maximum potential. A fifty-year plan enables a city or county to make long-term investments in much-needed infrastructure, and do so in a way that feels appropriate to the time horizon. A fifty-year plan enables residents to think about their choices as their grandchildren and great grandchildren will see them. And perhaps most important, a fifty-year plan gives a community a set of guiding and enduring principles that can better withstand term-by-term political pressure. 12. Invest in Strategic Foresight Strategic Foresight is a professional process to help a community assess trends, explore possible futures, and determine its future vision. Strategic Foresight was used to develop The Next Big Things. Here are several ways future-ready communities can employ the power of Strategic Foresight: o Conduct a trend analysis and scenario development workshop like the one offered in the premium version of this report. o Have a member of your staff trained in Strategic Foresight, and deploy them throughout the city (and community) to conduct foresight processes for departments and community stakeholders. The University of Houston offers a five day intensive certificate program in Strategic Foresight.52 o If you are an Alliance member, join the Future-Ready Cities Consortium. o Monitor. Trends do not remain static and future-ready communities will review their trends on a regular basis and adjust their plans as necessary. 52 Learn more: http://www.uh.edu/technology/programs/professional/foresight/ Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 74 73 IV. PUTTING IT TO WORK 13. Invest in Open Government and Smart Citizens The wisdom of crowds teaches that all of us are smarter than any one of us. By sharing community data and engaging your citizens – digitally and through “old school” methods – you receive a raft of community benefits that outweigh the hassle: o You engage citizens (Trend 41) o You leverage the benefits of open government and community solutions (Trend 10) o You deepen trust (Trend 38) o You facilitate social cohesion, and may breakdown tribalism (Trend 26) 14.Reinvent local government Why does local government exist, really? How has its purpose shifted since your city or county was founded? What should the role of government be for the next generation? The benefits of reinventing local government include: o Offering a more relevant mission and vision that will enable you to attract and keep great talent who are aligned with your purpose; o Re-energizing the electorate; o Recreating an organizational framework that enables you to redefine or restructure programs and departments so they can be more valuable, more effective…and more beloved o Eliminating programs that will not be needed in the future, or can be done more effectively by other stakeholders The threat is that if local governments don’t reinvent how they work, what they offer, and why they exist, others will do it for them. We are entering the city century. We must lead this effort, or we will be led. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 75 V. PREMIUM TOOLS AND RESOURCES #NBT Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 76 75 V. PREMIUM TOOLS AND RESOURCES The free version of this document does not include Section V. Members of the Alliance for Innovation or those who’ve paid for the premium version of the report have access to this section. Section V includes three activities to help communities put The Next Big Things to work, and become future ready. The activities are the Big Sort, Designing Community Scenarios, and a Foresight Workshop, which includes the previous activities in one, day-long whiz-bang workshop. Please visit transformgov.org for more information about membership or to purchase the premium report. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 77 VI. METHODOLOGIES AND REFERENCES Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 78 77 The following methodologies were used to inform The Next Big Things: o Dr. Charles Grantham conducted a Delphi Panel including dozens of subject matter experts to determine local government’s possible futures. o A team led by Rebecca Ryan conducted a literature scan to determine what else was being written about and studied regarding the future of cities, counties and local government. Most of those resources are listed below. If you would like to receive a Drop box link to many of the original materials in this library of resources, please email rr@nextgenerationconsulting.com. o A team of experienced and emerging City Managers worked alongside international architects, futurists, and innovators to develop the scenarios for the future of communities. The following books and articles were used to inform The Next Big Things: Aylett, Alexander. 2014. “Progress and Challenges in the Urban Governance of Climate Change: Results of a Global Survey.” Cambridge, MA: MIT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Hemment, Drew, and, Anthony Townsend, eds. 2014. “Smart Citizens.” Manchester, UK: Future Everything Publications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . National Intelligence Council. 2008. “Global Trends 2025: A Transformed World.” Washington, D.C. ISBN 978-0-116-081834-9. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Tuttle, Johanna Nesseth. 2012. “Private-Sector Engagement in Food Security and Agricultural Development.” Washington, D.C.: Center for Strategic and International Studies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Centers for Disease Control and Prevention. 2013. The State of Aging and Health in America 2013. Atlanta, GA: Centers for Disease Control and Prevention, US Dept of Health and Human Services. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Tuttle, Johanna Nesseth and Kristin Wedding. 2012. “Will Food Prices Drive Insecurity?” Washington, D.C.: Center for Strategic and International Studies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Tuttle, Johanna Nesseth and Anna Applefield. 2012. “The U.S. Drought.” Washington, D.C.: Center for Strategic and International Studies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Smith, Lawrence C. Four Forces Shaping Civilization’s Northern Future. 2011. New York City: Plume. VI. METHODOLOGIES AND REFERENCES Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 79 78 Fountain, Henry. “Researchers Link Syrian Conflict to a Drought Made Worse by Climate Change.” New York Times. March 2, 2015. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . National League of Cities. “The Ten Critical Imperatives Facing America’s Cities.” 2013. Washington, D.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Price, Gareth, et. al. “Attitudes to Water in South Asia.” 2014. London, England: Chatham House, The Royal Institute of International Affairs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Woolridge, Adrian. “Test Tube Government.” The Economist. December 6, 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Edmiston, Kelly D. “State and Local E-Government Prospects and Challenges. American Review of Public Administration, Vol. 33 No. 1. March 2003, 20-45. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Office of Economic Policy. 2014. “Expanding our Nation’s Infrastructure through Innovative Financing.” Washington DC: US Department of the Treasury. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Desouza, Kevin C. and Akshay Bhagwater. 2014. “Technology-Enabled Participatory Platforms for Civic Engagement: The Case of U.S. Cities.” Journal of Urban Technology, 21.4, 25-50, DOI 10.1080/10630732.2014.954898. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Broun, Denis. “Trends Talk: Innovative Finance and its Promise for Global Health.” Interview with PSI and Devex, April 2, 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Swindell, David, Stephanie Gerrestsen, and Mark S. Rosentraub. 2014. “The Jobs are Back, but Where? Implications for How Best to Pay for Local Government Services.” State and Local Government Review, Vol. 46(4) 260-271. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Runde, Daniel F. 2015. “Urbanization, Opportunity, and Development.” Washington, D.C.: Center for Strategic and International Studies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Lefevre, Mathieu, and Ricardo Mastini. “The Mighty Metropolis.” The World Today. February- March 2015. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Malmö Smart Citizen Services Network. 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . United Nations. “Population Challenges and Development Goals.” 2005. New York: United Nations Department of Economic and Social Affairs, Population Division. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cambanis, Thanassis. 2013. “Is Dubai the Future of Cities?” The Internationalist. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 80 79 Wright, Bradley E., Donald P. Moynihan, and Sanjay K. Pandey. “Pulling the Levers: Transformational Leadership, Public Service Motivation, and Mission Valence.” Public Administration Review. March-April 2012. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Fernandez, Sergio and Hal GT. Rainey. “Managing Successful Organizational Change in the Public Sector.” Public Administration Review. March-April 2006. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Briffault, Richard. “The Local Government Boundary Problem in Metropolitan Areas.” Stanford Law Review. May 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Warner, Mildred E. “The Future of Local Government: Twenty-First-Century Challenges.” Public Administration Review. December 2010. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Behn, Robert D. “The Big Questions of Public Management.” Public Administration Review. July-August 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kettl, Donald G. “The Transformation of Governance: Globalization, Devolution, and the Role of Government.” Public Administration Review. November-December 2000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “A Long and Winding Road.” The Economist. March 22, 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Runde, Daniel F., and Conor M. Savoy. 2014. “Resilience: A Critical Framework for Development.” Washington, D.C.: Center for Strategic and International Studies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ostrom, Vincent, and Elinor Ostrom. “Public Choice: A Different Approach to the Study of Public Administration.” Pubic Administration Review. March-April, 1971. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bosworth, Barry, and Sveta Milusheva. 2011. “Innovation in U.S. Infrastructure Financing: An Evaluation.” Washington, D.C.: The Brookings Institution. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cramer, Katherine J. 2014. “Understanding the Politics of Resentment: Rural Consciousness and Support for Small Government.” Madison, WI: University of Wisconsin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bradbury, Mar D., and J. Edward Kellough. 2007. “Representative Bureaucracy: Exploring the Potential for Active Representation in Local Government.” Journal of Public Administration Research and Theory, Inc. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sommers, Cecily. 2014. Think Like a Futurist: Know What Changes, What Doesn’t, and What’s Next. San Francisco: Jossey-Bass. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Mossberger, Karen, Caroline J. Tolbert, and Ramona S. McNeal . 2008. Digital Citizenship: The Internet, Society, and Participation. Massachusetts: MIT Press VI. METHODOLOGIES AND REFERENCES Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 81 80 “Ten-Year Forecast.” Institute for the Future. 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Marien, Michael. “15 Global Challenges Facing Humanity.” Future Survey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Glenn, Jerome C., Theodore J. Gordon, and Elizabeth Florsecu. “2013-14 State of the Future.” The Millenium Project. 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jacobson Ph.D, Robert, Douglas Bors, and Zern Liew. “Smart Citizens L.A.” Bluefire Consulting. June 1, 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jacobson Ph.D, Robert. “Actualizing Smart Citizens in Pima-Tuscon.” October 29, 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Lochocki, Timo. “Pegida Can be Tamed.” The World Today. February-March 2015. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Carter, Timothy. “Smart Cities: The future of urban infrastructure.” BBC. November 22, 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Hill, Dan. “On the smart city; Or, a ‘manifesto’ for smart citizens instead.” City of Sound. February 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Data: A Foundation for Tomorrow’s Cities.” Computation Institute. November 25, 2013 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Gonzales, Gladys, Tom Miller, Gary Cain, Kelly Bearden, Lea Deesing, David Hutchins, and Ted Smith. “Positioning your Community to Thrive: Technologies, Tips and Tools to Spur Economic Development in Local Government.” Government Technology. 2013 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Some Elements of the Next Global Economic System: How Might These New Elements Affect the Human Condition over the Next 20 Years?” The Millennium Project. 2010 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Environmental Security Study: Emerging International Definitions, Perceptions, and Policy Considerations.” The Millennium Project. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jacobson Ph.D, Robert. “‘Smart Citizens’ for Malmö, Sweden.” Atelier Tomorrow. December 9, 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Millennium 3000 Scenarios.” Millennium Project. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Grantham Ph.D, Charles. “The robots are coming, the robots are coming…” The Community Design Institute. 2015. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Millennium Project Scenarios: Global Normative Scenario.” Millennium Project. THE NEXT BIG THINGS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 82 81 “Global Trends 2030: Alternative Worlds.” The National Intelligence Council. November 2012. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Finger, C Thomas. “Global Trends 2025: A Transformed World.” The Office of the Director of National Intelligence. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kirby, Terry. “Getting Smart Cities Connected.” The Guardian. 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Hemment, Drew and Anthony Townsend. “Smart Citizens.” FutureEverything Publications. 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kannan, P.K., and Ai-Mei Chang. “Beyond Citizen Engagement: Involving the Public in Co- Delivering Government Services”. IBM Center for the Business of Government. 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Townsend, Anthony, Rachel Maguire, Mike Liebhold, and Mathias Crawford. “A Planet of Civic Laboratories: The Future of Cities, Information, and Inclusion.” Institute for the Future. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . “Citizens Make the Future.” 2013. Institute for the Future . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cambanis, Thanassis. “Is Dubai the future of cities?” The Internationalist. December 1, 2013. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . King, Cheryl Simerll, Kathryn M. Feltry, and Bridget O’Neill Susel. “The Question of Participation: Toward Authentic Public Participation in Public Administration.” Public Administration Review. July-August 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Elgin, Duane S., and Robert A. Bushnell. “The Limits to Complexity: Are Bureaucracies Becoming Unmanageable?” The Futurist. December 1977. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Lindblom, Charles. “The Science of ‘Muddling Through’”. Public Administration Review. 1959. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bailey, Rob, Antony Froggatt, and Laura Wellesley. “Livestock - Climate Change’s Forgotten Sector: Global Public Opinion on Meat and Dairy Consumption.” The Royal Institute of International Affairs. December 2014. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kassakian, John G. and Schmalansee, Richard, “The Future of the Electric Grid,” 2011. Cambridge: Massachusetts Institute of Technology. VI. METHODOLOGIES AND REFERENCES Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 83 VII. ACKNOWLEDGMENTS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 84 83 The Next Big Things was enabled and supported by the ambition and effort of these people: o Karen Thoreson, President, Alliance for Innovation o Toni Shope, Strategic Initiatives Director, Alliance for Innovation o Rebecca Ryan, Founder of NEXT Generation Consulting, Inc, served as the lead consultant and lead author of this project o Nicholas Huff, Design Specialist, Huffo Design The Alliance Board of Directors: o Paul Arevalo, City Manager, West Hollywood, CA o Darin Atteberry, City Manager, Fort Collins, CO o Michael Baker, Deputy Village Administrator, Downers Grove, IL o Kevin C. Desouza, PhD, Associate Dean for Research, College of Public Service & Community Solutions and Foundation Professor, School of Public Affairs Arizona State University o Charles M. Duggan, Jr., City Manager, Auburn, AL o Lee Feldman, City Manager, Fort Lauderdale, FL o Shannon Flanagan-Watson, (Board Vice-Chair), Assistant County Manager, Arlington County, VA o Elizabeth Fretwell, City Manager, Las Vegas, NV o Jimmy Jayne, County Manager, Navajo County, AZ o Jim Keene, City Manager, Palo Alto, CA o Tom Lundy, County Manager, Catawba County, NC o Peggy Merriss, City Manager, Decatur, GA o Terrence Moore, City Manager, College Park, GA o Karen Mossberger, Director, School of Public Affairs, Arizona State University o Robert J. O’Neill, Jr., Executive Director, ICMA VII. ACKNOWLEDGMENTS Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 85 84 THE NEXT BIG THINGS The Alliance Board of Directors: o Marc Ott, City Manager, Austin, TX o Clay Pearson, City Manager, Pearland, TX o Randall H. Reid, Southeast Regional Director, ICMA o Reina Schwartz, Assistant City Manager, San Pablo, CA o Garth Sherwin, City Manager, Lethbridge, AB, Canada o David Swindell, PhD, Director & Associate Professor, Arizona State University, Center for Urban Innovation o Jackson C. Tuttle II, (Retired), Former City Manager, Williamsburg, VA o J. Michael Wilkes, (Board Chair), City Manager, Olathe, KS The Next Big Things Steering Committee o Thomas Bonfield, City Manager, Durham, NC o Kevin C. Desouza, PhD, Associate Dean for Research, College of Public Service & Community Solutions and Foundation Professor, School of Public Affairs Arizona State University o James Keene, City Manager, Palo Alto, CA o Peggy Merriss, City Manager, Decatur, GA o Robert J. O'Neill, Executive Director, ICMA o Daniel Ortiz-Hernandez, City Administrator, Kimball, NE o Marc Ott, City Manager, Austin, TX o Rebecca Ryan, President, NEXT Generation Consulting, Inc. o Reina Schwartz, Assistant City Manager, San Pablo, CA o Toni Shope, Strategic Initiatives Director, Alliance for Innovation o Karen Thoreson, President, Alliance for Innovation o Jackson C. Tuttle II, (Retired), Former City Manager, Williamsburg, VA Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 86 85 VII. ACKNOWLEDGMENTS Delphi Panel Participants o Peter Bishop, Retired Associate Professor of Strategic Foresight, University of Houston o Peter Block, Author, Consultant, and Speaker o Simon Farbrother, City Manager, City of Edmonton, AB o Ted Gaebler, Retired City Manager o Ben Hecht, President & CEO, Living Cities o Katy Simon Holland, President, Simon and Associates o Robert, Jacobson, Principal, Praxis Innovation by Design o Elizabeth Kellar, President & CEO, Center for State and Local Government Excellence o Henry King, Innovation Strategist and Founder, King Innovation Group o Felicia Logan, Director of Leadership Development, ICMA o John Nalbandian, Professor, Public Administration, University of Kansas o Julia Novak, President, Novak Consulting Group o Robert J. O'Neill, Jr., Executive Director, ICMA o Ari Popper, Founder/CEO, SciFutures o Jim Spore, City Manager, City of Virginia Beach, VA o Sherry Weesner, Director of Projects, Scenic Houston Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 87 86 THE NEXT BIG THINGS Forecasting Workshop Participants o Mark Aesch, Client Partner, TransPro Consulting o Dr. Peter Bishop, Executive Director, Teach the Future o Chase Carlile, Senior Budget Analyst, City of Mesa, AZ o Sam Feldman, Former Management Assistant II, City of Phoenix, AZ o Charlie Grantham, Founder, Community Design Institute o Michael Hodge, Architect, Rumblespring o Katy Simon Holland, President, Simon and Associates Consulting o Jimmy Jayne, County Manager, Navajo County, AZ o Peggy Merriss, City Manager, City of Decatur, GA o Karen Mossberger, Director, School of Public Affairs, Arizona State University o Marc Ott, City Manager, City of Austin, TX o Dominic Papa, Marvin Andrews Fellow, Arizona State University o Stephanie Smith, Assistant to the City Manager, City of Flagstaff, AZ o Brent Stockwell, Assistant City Manager, City of Scottsdale, AZ o Pam Weir, Management Analyst, City of Sierra Vista, AZ Scenario Development Team o Dr. Peter Bishop, Executive Director, Teach the Future o Charlie Grantham, Founder, Community Design Institute o Katy Simon Holland, President, Simon and Associates o Kris Kluthe, Senior Motion Designer, Planet Propaganda Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 88 If you have questions about The Next Big Things, please contact the Alliance for Innovation. Phone: 888.496.0944 Email: nbt@transformgov.org Copyright © 2015 by Alliance for Innovation, Inc. All rights reserved. This publication or any portion thereof may not be reproduced or used in any manner whatsoever without the express written permission of the publisher except for the use of brief quotations in a publications review. Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 89 411 N Central Ave, Suite 400 Phoenix, AZ 85004 Phone: 888.496.0944 transformgov.org Special Study Session Meeting of April 17, 2017 (Item No. 2) Title: Vision 3.0 Trends Exercise Page 90 Meeting: Special Study Session Meeting Date: April 17, 2017 Written Report: 3 EXECUTIVE SUMMARY TITLE: Advancing Race Equity: Next Steps for 2017 RECOMMENDED ACTION: The City Council is asked to review and implement next steps including outreach in community and communication with the Human Rights Commission. POLICY CONSIDERATION: Is any other information needed? SUMMARY: On March 20, 2017, Consultant Gordon Goodwin facilitated a conversation with Council on next steps on advancing race equity as it relates to their action plan. The focus was on further defining next steps for outreach and communication with the Human Rights Commission (HRC) as follow up to the January joint meeting. Below is the plan summary for next steps: Outreach in Community with Other Groups/Partners •In preparation for the community information sessions noted below, the Mayor and City Manager will coordinate a meeting with a number of interested parties to connect on what is happening with race equity advancement. Set up initial meeting and determine future check in (City of St. Louis Park, School District, Allies of SLP, HRC Chair, MAC, others). Follow Up Communication with HRC •Council respectfully requests HRC host up to six City of St. Louis Park racial equity information sessions for St. Louis Park resident associations by year end 2017. These sessions should engage all segments of our community, especially reputational leaders of ethnic and racially diverse groups living in St. Louis Park. These information sessions will serve as an orientation to the City of St. Louis Park racial equity approach. Possible questions discussed in these sessions could include: − Why is racial equity the focus of our work? − What are some desired results for racial equity in the City of St. Louis Park? − How might St. Louis Park residents’ lives be positively impacted by the City of St. Louis Park racial equity initiative? − How can St. Louis Park residents help with this effort? Next Steps: If acceptable with Council, staff will forward this information to HRC for their information, guidance and comments on moving forward in 2017. FINANCIAL OR BUDGET CONSIDERATION: Not applicable. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Discussion Prepared by: Nancy Deno, Deputy City Manager/HR Director Approved by: Tom Harmening, City Manager Special Study Session Meeting of April 17, 2017 (Item No. 3) Page 2 Title: Advancing Race Equity: Next Steps for 2017 DISCUSSION On January 23, 2017, Council held a joint meeting with the Human Rights Commission (HRC) and Multi-Cultural Advisory Group. This meeting was facilitated by Consultant Gordon Goodwin from the Center for Social Inclusion (CSI). On January 27, 2017, the Council discussed advancing race equity and developed action plan steps at their workshop. On March 20, 2017, Consultant Gordon Goodwin facilitated a conversation with Council on next steps on advancing race equity as it relates to their action plan. The focus was on further defining next steps for numbers three and four noted below, particularly related to providing guidance to the Human Rights Commission (HRC) as follow up to the January joint meeting. Below is the 2017 Council Action Plan on Advancing Race Equity 2017, including further definition for steps three and four: Advancing Race Equity - Council Action Plan: Measurable Steps for 2017 1.Gather information during Vision process on advancing racial equity, hearing voices and include in all areas of Vision/Comp Plan. Comment: In process. 2.Workforce Initiatives Comment: Staff will incorporate into action plans when they are developed in April 2017. − Staffing initiatives to include avenues for success in hiring and advancing racial equity in our workplace. − Contractors and wealth creation (opportunities that open up inclusion with underrepresented groups/vendors). 3.Council to work on connecting with potential leaders in the community to diversify boards, commissions and involvement in other areas. − In preparation for the community information sessions noted below, the Mayor and City Manager will coordinate a meeting with a number of interested parties to connect on what is happening with race equity advancement. Comment: In process − Set up initial meeting and determine future check in (City of St. Louis Park, School District Allies of SLP , HRC Chair, MAC, others). Comment: In process 4.Council to work with HRC to continue to increase awareness in advancement of racial equity in the community, including outreach. •Council respectfully requests HRC host up to six City of S t. Louis Park racial equity information sessions for St. Louis Park resident associations by year end 2017. These sessions should engage all segments of our community, especially reputational leaders of ethnic and racially diverse groups living in St. Louis Park. •These information sessions will serve as an orientation to the City of St. Louis Park racial equity approach. Possible questions that could be discussed in these sessions include: − Why is racial equity the focus of our work? − What are some desired results for racial equity in the City of St. Louis Park? − How might St. Louis Park residents’ lives be positively impacted by the City of St. Louis Park racial equity initiative? − How can St. Louis Park residents help with this effort? Meeting: Special Study Session Meeting Date: April 17, 2017 Written Report: 4 EXECUTIVE SUMMARY TITLE: Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 RECOMMENDED ACTION: None at this time. Please review the information on the proposed Major Amendments to Parkway 25 PUD Section 26-268 PUD 7. POLICY CONSIDERATION: Does the City Council support the proposed Major Amendment to the Parkway 25 PUD? SUMMARY: Parkway 25, LLC has submitted an application for a Major Amendment to Section 26-268 PUD 7 that established the zoning for the Parkway 25 redevelopment located at 4005, 4015, & 4027 County Road 25 (the former Vescio’s restaurant and Valu Stay Inn). City Council approved the Parkway 25 PUD in September 2016 which allowed for the construction of a five story, mixed-use building with 112 residential units, approximately 8,850 square feet of ground floor commercial space, and parking located in two surface lots and in an underground parking ramp. The original proposal included a restaurant and a fitness center. The applicant is requesting an amendment to the PUD to allow for medical uses and to increase the size of the commercial square footage from 8,850 square feet to 12,040 square feet. The plan would decrease the west surface parking lot from 25 spaces to 14 spaces to accommodate the additional commercial space, and reduce the east surface parking lot from 30 parking spaces to 29 spaces to install a turnaround space. The change from restaurant to medical office decreases the parking demand and parking counts would meet the city requirements. The additional 3,190 square feet of commercial space would be added to the west side of the building’s ground floor, which was previously 9 parking spaces located under a cantilevered portion of building. The additional commercial space requires the parking lot to be shifted 5 feet to the west to allow for increased circulation, resulting in the removal of landscaping on the west property line. Additional landscaping is being installed elsewhere on the site to make up for the removals. The development will include 112 residential dwelling units and will remain 5 stories in height. The only proposed changes occur on the ground floor of the building. In order to accommodate the developer’s critical path schedule for construction financing, staff requests the city council hold a special meeting on April 24, 2017, to consider the first reading of the ordinance and schedule the second reading for May 1, 2017. FINANCIAL OR BUDGET CONSIDERATION: None at this time. VISION CONSIDERATION: St. Louis park is committed to providing a well-maintained and diverse housing stock. SUPPORTING DOCUMENTS: Proposed Development Plans Prepared by: Jennifer Monson, Planner Reviewed by: Sean Walther, Planning and Zoning Supervisor Michele Schnitker, Deputy CD Director Approved by: Tom Harmening, City Manager Special Study Session Meeting of April 17, 2017 (Item No. 4) Title: Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 Page 2 Special Study Session Meeting of April 17, 2017 (Item No. 4) Title: Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 Page 3 Special Study Session Meeting of April 17, 2017 (Item No. 4) Title: Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 Page 4 Special Study Session Meeting of April 17, 2017 (Item No. 4) Title: Parkway 25 – PUD Major Amendment to Section 26-268 PUD 7 Page 5 Meeting: Economic Development Authority Meeting Date: April 17, 2017 Minutes: 3a UNOFFICIAL MINUTES ECONOMIC DEVELOPMENT AUTHORITY ST. LOUIS PARK, MINNESOTA MARCH 20, 2017 1. Call to Order President Mavity called the meeting to order at 7:20 p.m. Commissioners present: President Anne Mavity, Tim Brausen, Steve Hallfin, Gregg Lindberg, Thom Miller, Susan Sanger, and Jake Spano. Commissioners absent: None. Staff present: Executive Director (Mr. Harmening), Economic Development Coordinator (Mr. Hunt), Community Development Director (Mr. Locke), City Attorney (Mr. Mattick), Chief Financial Officer (Mr. Simon), Deputy City Manager/Human Resources Director (Ms. Deno), Fire Chief (Mr. Koering), Senior Planner (Mr. Walther), and Recording Secretary (Ms. Pappas). Guests: Tom Tracy, Senior VP, Excelsior Group. 2. Roll Call 3. Approval of Minutes 3a. Economic Development Authority Meeting Minutes March 6, 2017 It was moved by Commissioner Sanger, seconded by Commissioner Hallfin, to approve the EDA minutes as presented. The motion passed 7-0. 4. Approval of Agenda It was moved by Commissioner Brausen, seconded by Commissioner Spano, to approve the EDA agenda as presented. The motion passed 7-0. 5. Reports – None 6. Old Business – None 7. New Business 7a. Fourth Amendment to Central Park West Redevelopment Contract. Resolution No. 17-03. Economic Development Authority Meeting of April 17, 2017 (Item No. 3a) Page 2 Title: Economic Development Authority Meeting Minutes of March 20, 2017 Mr. Hunt presented the staff report. He explained that the developer of Central Park West has requested a one-year extension under the Contract for Private Redevelopment with Central Park West, LLC, to allow their development team sufficient time to reach their pre- leasing threshold for the required buildings. Under the proposed Fourth Amendment to the redevelopment contract, the required commencement and completion dates for Phases 4 and 5 would be modified to dates noted in the report. Commissioner Brausen stated he is supportive of this, adding he would encourage the developer, as they look for an anchor tenant, to seek out companies that offer more space to their employees’ work stations and not just provide 10 x 10 cubicles. Commissioner Sanger stated she understands why Phase 4 was postponed because of the lack of an anchor tenant but asked why Phase 5 is being stalled. Mr. Tracy, Senior VP, Excelsior Group, stated they would like to break ground on both Phase 4 and 5; however, it is taking some time to fill the space. He noted they are now working with Ryan Companies; have hired Transwestern for marketing the space; and are moving along in the process and getting prospects. He stated they are working very hard to lease the space but need more time. Commissioner Sanger stated this explains the delay with Phase 4, but not Phase 5. She stated she is tired of approving extensions and would like to have the whole development up and running. Commissioner Spano asked if the duration of the project will be changed, if the TIF amount will then be different, as well. Mr. Hunt stated the construction delay will delay the generation of tax increment but the term of the TIF district, 26 years, remains the same. It was moved by Commissioner Brausen, seconded by Commissioner Lindberg, to adopt EDA Resolution No. 17-03, approving the Fourth Amendment to the Contract for Private Redevelopment with Central Park West, LLC. The motion passed 7-0. 7b. Call for Public Hearing to Consider Establishment of the Wooddale Station TIF District. Resolution No. 17-04. Mr. Hunt presented the staff report. He noted the project’s final pro forma exhibits a financial gap which precludes the project from proceeding. Accordingly, the developer submitted an application for TIF assistance. PLACE’s revised project plans and initial TIF request were reviewed at the February 13, 2017, Study Session, where they received favorable support. The EDA also received a more in-depth staff report on the application at the March 13, 2017, Study Session. Mr. Hunt stated the TIF program is administered by the EDA; however, in order to create a TIF district, city councils are statutorily required to hold a public hearing to establish them. To start the TIF district process, the EDA must formally request the city council to set a date and hold a public hearing. Calling for the public hearing is the first step in the Economic Development Authority Meeting of April 17, 2017 (Item No. 3a) Page 3 Title: Economic Development Authority Meeting Minutes of March 20, 2017 formal creation of the Wooddale Station Tax Increment Financing District. The public hearing is scheduled for May 1st. Commissioner Brausen asked if there will be a separate TIF district for the PLACE development later on. Mr. Hunt stated the Wooddale Station TIF District would be created to accommodate the PLACE project. Commissioner Brausen asked if this will be separate from the proposed Elmwood TIF district also being discussed. Mr. Hunt stated they will be two entirely separate TIF districts. Commission Sanger stated she is voting no, and is not in favor of the PLACE project. It was moved by Commissioner Brausen, seconded by Commissioner Lindberg, to adopt EDA Resolution No. 17-04, requesting the city council to call for a public hearing relative to the establishment of the Wooddale Station Tax Increment Financing District within Redevelopment Project No 1. The motion passed 6-1. (Commissioner Sanger opposed). 8. Communications – None 9. Adjournment The meeting adjourned at 7:33 p.m. _____________________________________ _____________________________________ Melissa Kennedy, Secretary Anne Mavity, President Meeting: Economic Development Authority Meeting Date: April 17, 2017 Action Agenda Item: 7a EXECUTIVE SUMMARY TITLE: Grant Applications for the PLACE Project RECOMMENDED ACTION: 1)Motion to Adopt EDA Resolution authorizing the submission of a grant application to the Department of Employment and Economic Development (DEED) Contamination Clean-up Grant Program on behalf of the PLACE project; 2)Motion to Adopt EDA Resolution authorizing the submission of a grant application to the Metropolitan Council Tax Base Revitalization Grant Program on behalf of the PLACE project; 3)Motion to Adopt EDA Resolution authorizing a grant application to the Metropolitan Council Livable Communities Transit Oriented Development (LCA-TOD) Program for development activities for PLACE. POLICY CONSIDERATION: Does the EDA support submitting grant applications to assist in environmental cleanup and transit oriented development activities by PLACE for its proposed redevelopment at the SE quadrant of Highway 7 and Wooddale Ave? SUMMARY: Last fall, the EDA applied for contamination clean-up grants from Hennepin County and Department of Employment and Economic Development (DEED) on behalf of PLACE to help defray the cost of mitigating the contaminated soils found on-site. Hennepin County awarded the EDA a $92,230 ERF grant, however, DEED did not award any funds as it believed the project was not fully prepared to proceed. This spring PLACE is once again requesting the EDA apply for approximately $600,000-$800,000 in contamination clean up grants from the Metropolitan Council and DEED in another attempt to mitigate costs associated with the cleanup of the contaminated soils on-site. The clean-up grant applications are due May 1. PLACE is also requesting the EDA to apply for a $850,000 Livable Communities Transit Oriented Development (LCA-TOD) grant from Metropolitan Council for public infrastructure and placemaking elements to be incorporated in the PLACE project. All of these grant applications require a resolution of support from the governing body of the city where the project is located. The resolutions are attached. FINANCIAL OR BUDGET CONSIDERATION: The EDA is the designated applicant for the grants but has no financial obligation other than to serve as the conduit for the grant funds. VISION CONSIDERATION: St. Louis Park is committed to providing a well-maintained and diverse housing stock. SUPPORTING DOCUMENTS: Discussion EDA Resolutions Prepared by: Julie Grove, Economic Development Specialist Reviewed by: Greg Hunt, Economic Development Coordinator Michele Schnitker, Housing Supervisor/Deputy CD Director Approved by: Tom Harmening, City Manager Economic Development Authority Meeting of April 17, 2017 (Item No. 7a) Page 2 Title: Grant Applications for the PLACE Project DISCUSSION BACKGROUND: Environmental investigations were completed last fall on the proposed PLACE redevelopment sites located at the SE quadrant of Highway 7 and Wooddale Ave and the northeast corner of W 36th Street and Wooddale Ave. It was determined soils in portions of both sites are contaminated with diesel range organics, arsenic, cadmium, silver, lead and perchloroethylene. In addition, underground tanks were found on the McGarvey site and old railroad ties were found on the site to the north, adjacent to the railroad tracks. The sites are also contaminated with soil gases, specifically volatile organic compounds (VOCs) which will require vapor mitigation. To address the above contamination, grant funds were requested last fall from DEED’s Contamination Cleanup grant program and Hennepin County’s Environmental Response Fund. Hennepin County awarded the EDA $92,230. DEED chose not to award any grant funds as it believed the project was not fully prepared to proceed. This spring, PLACE has requested the EDA reapply for the DEED Contamination Cleanup grant and for a Metropolitan Council Tax Base Revitalization Grant to help mitigate the costs associated with the cleanup of the contaminated soils. The total amount of cleanup funds being requested from the Metropolitan Council and DEED is approximately $600,000-$800,000. These grant applications are due May 1, 2017. Grant awards are anticipated to be announced in late June or early July. PLACE is also requesting the EDA apply for LCA-TOD grant funds from the Metropolitan Council in the amount of $850,000 to be used for: solar panels, a placemaking plaza (woonerf), and public art. This grant program requires the submittal of a project concept plan application on May 4th and full application is due June 29th. Each grant requires a resolution from the governing body of the city where the project site is located indicating that it supports the project. A resolution for each grant application is attached. It should be noted that approving an authorizing resolution and resolution of support for the grants does not mean the EDA is or will approve the PUD or Plat and TIF applications. These grant applications do not require a matching contribution from the EDA. The EDA will serve as the conduit and administrator of the funds. PLACE redevelopment has thus far received the following grants. •$100,000 - Metropolitan Council Livable Communities Transit-Oriented Development Pre- Development Grant. •$2,000,000 – Metropolitan Council Livable Communities Demonstration Account Transit- Oriented Development Grant. •$750,000 – Hennepin County Transit-Oriented Development Grant. •$385,000 Xcel Energy Efficiency Grant. •$92,230 Hennepin County ERF clean up Grant. Economic Development Authority Meeting of April 17, 2017 (Item No. 7a) Page 3 Title: Grant Applications for the PLACE Project EDA RESOLUTION NO. 17-____ RESOLUTION APPROVING A GRANT APPLICATION TO THE DEPARTMENT OF EMPLOYMENT AND ECONOMIC DEVELOPMENT AND APPROVING LOCAL MATCHING FUNDS ON BEHALF OF PLACE WHEREAS, the St. Louis Park Economic Development Authority (“EDA”) has agreed to act as the legal sponsor for the Project referred to as PLACE, contained in the Contamination Cleanup Grant application submitted to the Department of Employment and Economic Development (DEED) on or before May 1, 2017; and WHEREAS, the City of St. Louis Park is located within the seven county metropolitan area defined in section 473.121, subdivision 2, and is participating in the local housing incentives program under section 473.254. WHEREAS, the St. Louis Park EDA has the legal authority to apply for financial assistance, and the institutional, managerial, and financial capability to ensure adequate project administration; and WHEREAS, the sources and amounts of the local match identified in the application are committed to the project identified and the advance of such funds is subject to the final approval of the EDA; and WHEREAS, the St. Louis Park EDA has not violated any Federal, State or local laws pertaining to fraud, bribery, graft, kickbacks, collusion, conflict of interest or other unlawful or corrupt practice; and WHEREAS, upon approval of its application by the state, the St. Louis Park EDA may enter into an agreement with the State of Minnesota for the above referenced Project, and that the St. Louis Park EDA certifies that it will comply with all applicable laws and regulation as stated in all contract agreements; WHEREAS, the St. Louis Park EDA has approved the Contamination Cleanup grant application submitted to the DEED on May 1, 2017, for the PLACE site. NOW, THEREFORE, BE IT RESOLVED that the President and Executive Director are hereby authorized to apply to the DEED for funding of this project on behalf of the St. Louis Park EDA and execute such agreements as are necessary to implement the grant on behalf of the applicant. I CERTIFY THAT the above resolution was adopted by the St. Louis Park Economic Development Authority on, April 17, 2017. Reviewed for Administration: Adopted by the Economic Development Authority, April 17, 2017 Thomas K. Harmening, Executive Director Anne Mavity, President Attest Melissa Kennedy, Secretary Economic Development Authority Meeting of April 17, 2017 (Item No. 7a) Page 4 Title: Grant Applications for the PLACE Project EDA RESOLUTION NO. 17-____ RESOLUTION AUTHORIZING APPLICATION FOR THE METROPOLITAN COUNCIL TAX BASE REVITALIZATION ACCOUNT ON BEHALF OF PLACE WHEREAS, the City of St. Louis Park is a participant in the Livable Communities Act's Local Housing Incentives Account Program for 2017 as determined by the Metropolitan Council, and is therefore eligible to make application for funds under the Tax Base Revitalization Account; and WHEREAS, the St. Louis Park Economic Development Authority (“EDA”) has identified a clean-up project within the City that meets the Tax Base Revitalization account's purposes and criteria and are consistent with and promote the purposes of the Metropolitan Livable Communities Act and the policies of the Metropolitan Council’s adopted metropolitan development guide; and WHEREAS, the St. Louis Park EDA has the institutional, managerial and financial capability to ensure adequate project administration; and WHEREAS, the St. Louis Park EDA certifies that it will comply with all applicable laws and regulations as stated in the contract agreements; and WHEREAS the St. Louis Park EDA finds that the required contamination cleanup will not occur through private or other public investment within the reasonably foreseeable future without Tax Base Revitalization Account grant funding; and WHEREAS the St. Louis Park EDA represents that it has undertaken reasonable and good faith efforts to procure funding for the activities for which Livable Communities Act Tax Base Revitalization Account funding is sought but was not able to find or secure from other sources funding that is necessary for cleanup completion and states that this representation is based on the following reasons and supporting facts. NOW, THEREFORE, BE IT RESOLVED that the President and Executive Director are hereby authorized to apply to the Metropolitan Council for a Tax Base Revitalization Account grant and, if the St. Louis Park EDA is awarded a Tax Base Revitalization Account grant for this project, the EDA will be the grantee and agrees to act as legal sponsor to administer and be responsible for grant funds expended for the project contained in the Tax Base Revitalization grant application submitted on May 1, 2017. Reviewed for Administration: Adopted by the Economic Development Authority, April 17, 2017 Thomas K. Harmening, Executive Director Anne Mavity, President Attest Melissa Kennedy, Secretary Economic Development Authority Meeting of April 17, 2017 (Item No. 7a) Page 5 Title: Grant Applications for the PLACE Project EDA RESOLUTION NO. 17-____ RESOLUTION AUTHORIZING AN APPLICATION TO THE METROPOLITAN COUNCIL LIVABLE COMMUNITIES TRANSIT ORIENTED DEVELOPMENT FUNDING ON BEHALF OF PLACE WHEREAS, the St. Louis Park Economic Development Authority (“EDA”) is eligible to apply for Livable Communities Demonstration Account funds on behalf of cities participating in the Livable Communities Act’s (“LCA”) Housing Incentives Program for 2015 as determined by the Metropolitan Council; and WHEREAS, the EDA has identified a proposed TOD Project within the City of St. Louis Park that meets the Demonstration Account’s purposes and criteria and is consistent with and promotes the purposes of the Metropolitan Livable Communities Act and the policies of the Metropolitan Council’s adopted metropolitan development guide; and WHEREAS, the EDA has the institutional, managerial and financial capability to ensure adequate project administration; and WHEREAS, the EDA certifies that it will comply with all applicable laws and regulations as stated in the grant agreement; and WHEREAS, the EDA acknowledges Livable Communities Demonstration Account grants are intended to fund projects or project components that can serve as models, examples or prototypes for development or redevelopment elsewhere in the region, and therefore represents that the proposed projects or key components of the proposed projects can be replicated in other metropolitan-area communities; and WHEREAS, only a limited amount of grant funding is available through the Metropolitan Council’s Livable Communities Demonstration Account initiative during each funding cycle and the Metropolitan Council has determined it is appropriate to allocate those scarce grant funds only to eligible projects that would not occur without the availability of Demonstration Account grant funding. NOW THEREFORE BE IT RESOLVED that, the St. Louis Park EDA authorizes its’ Executive Director to submit an application for Metropolitan Council Livable Communities Demonstration Account grant funds for the project components identified in the application, and to execute such agreements as may be necessary to implement the projects on behalf of the St. Louis Park EDA, where the project is located. Reviewed for Administration: Adopted by the Economic Development Authority, April 17, 2017 Thomas K. Harmening, Executive Director Anne Mavity, President Attest Melissa Kennedy, Secretary Meeting: Economic Development Authority Meeting Date: April 17, 2017 Action Agenda Item: 7b EXECUTIVE SUMMARY TITLE: Excelsior & Monterey Redevelopment RECOMMENDED ACTION: Motion to deny the TIF application and decline the Developer’s offer to purchase the property at 3743 Monterey Drive. POLICY CONSIDERATION: Does the Authority support or not support selling the parcel at 3743 Monterey Drive and the tax increment financing application for the proposed Excelsior & Monterey Redevelopment? SUMMARY: St. Louis Park Leased Housing Associates I, LLC (the “Developer”) previously submitted an application for tax increment financing assistance in connection with a proposed development at the intersection of Excelsior Boulevard and Monterey Drive. Among the requests made by the Developer was an offer to purchase the property at 3743 Monterey Drive, which is currently owned by the Authority, in order to assemble the site necessary for the development. Under the EDA Act, the Authority may (but is not required to) sell its property if it determines that the sale is in the best interests of the city and its people, and that the transaction furthers its general plan of economic development. After extensive consideration of the TIF application and offer to purchase the EDA parcel it is found that it is not in the best interests of the City to sell the 3743 Monterey Drive parcel at this time. The appropriate action for the EDA at this time is an EDA motion to deny the TIF application and decline Developer’s offer to purchase the property at 3743 Monterey Drive. FINANCIAL OR BUDGET CONSIDERATION: Not applicable. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: None Prepared by: Sean Walther, Planning and Zoning Supervisor Approved by: Tom Harmening, City Manager Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2a EXECUTIVE SUMMARY TITLE: St. Louis Park Parktacular Ambassadors Introduction & Recap of Year RECOMMENDED ACTION: The 2016-2017 St. Louis Park Parktacular Ambassadors will be in attendance to introduce themselves to City Council. They will share information about their year as Ambassadors and some things they have learned from representing the community. POLICY CONSIDERATION: None SUMMARY: St. Louis Park Parktacular Ambassadors visit communities in the Twin Cities area and western Wisconsin. Besides representing the festival, they promote the City of St. Louis Park and the excellent schools. As an inclusive program, St. Louis Park is one of three communities (Hopkins and Woodbury being the others) who have representation from children, young adults, and seniors. Parktacular is the only program that has consistently had young men representing the City, as well as racial and ethnic diversity. Many other communities admire how we are so successful in getting a cross-section of the citizens of our city to represent our own community. SLP Parktacular Ambassadors are public servants and promote St. Louis Park as a place where all ages, religions, and ethnicities can live, learn, and participate in a strong community, which is well represented by the Parktacular Festival. FINANCIAL OR BUDGET CONSIDERATION: Not applicable. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: None Prepared by: Debbie Fischer, Administrative Services Office Assistant Approved by: Tom Harmening, City Manager Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2b EXECUTIVE SUMMARY TITLE: Volunteer Proclamation RECOMMENDED ACTION: The Mayor is asked to read and give thanks and appreciation to Board and Commission Volunteers and City Volunteers. This is for camera purposes, and the video will be shared with volunteers and social media in honor of Volunteer Recognition Day, April 20, 2017. POLICY CONSIDERATION: None at this time. SUMMARY: A background and update on volunteers is provided. In 2016, the City of St. Louis Park had 1,360 volunteers donate their time and talents, who contributed more than 10,000 hours. Below are several highlights from the past year: •The City has 73 volunteer Hydrant Heroes enlisted to dig out their hydrants each winter, ensuring quick access in case of an emergency. •Fire hydrant painting continued for its third year, with more than 100 hydrants getting a fresh coat of paint. •The City experienced a record number of parks, gardens and public spaces being adopted. Volunteers tend to more than 40 parks and public spaces and 24 gardens on a regular basis. •Community events were supported by volunteers, including the Home Remodeling Fair, Organic Living Workshop, Westwood Hills Nature Center Halloween Party, Open Street Events and Bike-way Demonstration Projects. •The Inspections Department hosted three volunteers who assisted in scanning building plans and organizing archived plans. •The Westwood Hills Nature Center received approximately 4,000 hours donated from volunteers. •The Police Department’s Basketball in the Park program continued free yoga in the park, led by volunteer yoga teachers. •The Fire Department trained its third class of Community Emergency Response Team volunteers. FINANCIAL OR BUDGET CONSIDERATION: None at this time. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Proclamation Prepared by: Laura Smith, Wellness and Volunteer Coordinator Reviewed by: Nancy Deno, Deputy City Manager/HR Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 2b) Page 2 Title: Volunteer Proclamation PROCLAMATION Honoring Boards and Commissions Volunteers and City Volunteers WHEREAS, citizen involvement enhances the quality and responsiveness of public decision making and the progress of the community; and WHEREAS, city volunteers are an essential part of St. Louis Park, vital to our future as a caring and productive community; and integral to our vision of becoming a connected and engaged community; and WHEREAS, city volunteers continue to selflessly give their compassion, time and commitment to better their community and the lives of others; and WHEREAS, city volunteers continue to make a difference through their hard work, dedication and outstanding contributions to the City of St. Louis Park; and WHEREAS, various Boards and Commissions serve in an advisory capacity to the City of St. Louis Park City Council and are conferred various degrees of decision making power of the City; and WHEREAS, the City of St. Louis Park welcomes its citizens to share their talents and perspectives by serving on an advisory Board or Commission; NOW THEREFORE, let it be known that the Mayor and City Council of the City of St. Louis Park do hereby commend volunteers of St. Louis Park and the volunteers of St. Louis Park Boards and Commissions for their dedicated service and outstanding contributions to improving the quality of lives of others, and supporting our community and its people. WHEREFORE, I set my hand and cause the Great Seal of the City of St. Louis Park to be affixed this 17th day of April, 2017. ___________________________________ Jacob Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2c EXECUTIVE SUMMARY TITLE: 2017 Arbor Day Proclamation RECOMMENDED ACTION: The Mayor is asked to read the Proclamation proclaiming May 6th as Arbor Day in St. Louis Park and the month of May as Arbor Month in St. Louis Park. POLICY CONSIDERATION: This action is consistent with policies adopted by the City Council. SUMMARY: St. Louis Park has been formally proclaiming and celebrating Arbor Day in St. Louis Park for over 37 years. With this proclamation, St. Louis Park has attained Tree City USA status for 37 consecutive years. Tree City USA status requires the city to officially proclaim an annual Arbor Day celebration, retain a “Tree Board” or unit serving as such, which is our Parks and Recreation Commission, and each city must provide a minimum of $2/capita into a community forestry program (the City of St. Louis Park provides $15/capita for our community forestry program). Arbor Day 2017 is set for Saturday, May 6th, from 9 - Noon, at the Rec Center campus. A diversity of 60 trees will be planted along the north east and southern edges of the parking lot. Our local tree planting partner, Tree Trust, will facilitate the planting. The Arbor Day celebration will include music by Kidpower with Rachael, Woodsy the Owl, refreshments and celebratory words from, hopefully, Mayor Spano and Councilmember Mavity. The City of St. Louis Park’s Community forestry program is very comprehensive, including disease and insect tree inspections and removals, tree planting, annual tree sale, rotational boulevard and park pruning, Emerald ash borer management and residential brush drop-off. The community forest of St. Louis Park is diverse with a variety of ages, sizes and tree species, found on public and private properties. There are approximate 15,000 boulevard trees and 75,000 park trees. FINANCIAL OR BUDGET CONSIDERATION: None VISION CONSIDERATION: St. Louis Park is committed to being a leader in environmental stewardship. We will increase environmental consciousness and responsibility in all areas of city business. SUPPORTING DOCUMENTS: Proclamation Prepared by: Jim Vaughan, Natural Resources Coordinator Reviewed by: Cynthia S. Walsh, Director of Operations & Recreation Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 2c) Page 2 Title: 2017 Arbor Day Proclamation PROCLAMATION Arbor Day 2017 WHEREAS, The health of the people is tied to the health of their forests; and WHEREAS, Trees and forests improve our physical health by cleaning the air, reducing exposure to the sun’s UV rays, and decreasing temperatures during the summer time; and WHEREAS, In 50 years, one tree provides $62,000 worth of air pollution control; and WHEREAS, Childhood asthma rates are lower in urban communities that have a higher density of trees; and WHEREAS, Trees and forests improve our mental health by reducing stress and increasing concentration; and WHEREAS, Community trees and forests create high-quality drinking water by acting as a natural filter; and WHEREAS, St. Louis Park has been recognized as a “Tree City USA” for 37 consecutive years and desires to continue its tree planting ways; and NOW THEREFORE, let it be known that the Mayor and City Council of the City of St. Louis Park, Minnesota, do herby proclaim Saturday, May 6, 2017 as ARBOR DAY and the month of May 2017 as ARBOR MONTH in the City of St. Louis Park; and LET IT FURTHER BE KNOWN that we urge all citizens to support efforts to protect and preserve our trees and woodlands and to support our City’s community forestry program. WHEREFORE, I set my hand and cause the Great Seal of the City of St. Louis Park to be affixed this 17th day of April, 2017. _________________________________ Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2d EXECUTIVE SUMMARY TITLE: 2017 International Compost Awareness Week Proclamation RECOMMENDED ACTION: The Mayor is asked to read the Proclamation proclaiming May 7 - 13, 2017, International Compost Awareness Week in St. Louis Park. POLICY CONSIDERATION: This action is consistent with policies adopted by the City Council. SUMMARY: International Compost Awareness Week (ICAW) is the largest and most comprehensive education initiative of the compost industry. Cities and states across the US, as well as Canada, Australia, and the UK celebrate organics recycling and composting efforts during this week. The City of St. Louis Park is a leader in organics recycling in the Twin Cities. Celebrating and promoting ICAW is one way for the city to encourage residents to participate in the residential organics recycling program and to support composting in Minnesota. FINANCIAL OR BUDGET CONSIDERATION: None. VISION CONSIDERATION: St. Louis Park is committed to being a leader in environmental stewardship. We will increase environmental consciousness and responsibility in all areas of city business. SUPPORTING DOCUMENTS: Proclamation Prepared by: Emily Barker, Solid Waste Program Specialist Reviewed by: Scott Merkley, Public Works Services Manager Cynthia S. Walsh, Director of Operations & Recreation Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 2d) Page 2 Title: 2017 International Compost Awareness Week Proclamation PROCLAMATION INTERNATIONAL COMPOST AWARENESS WEEK 2017 WHEREAS, the Composting Council Research and Education Foundation, along with Canada, Australia and the United Kingdom have declared the first week of May to be the annual International Composting Awareness Week; and WHEREAS, composting is an effective form of waste reduction and recycling, and since organic materials make up approximately 30% of the material in our trash, composting is a significant way for St. Louis Park to reduce waste and to help Minnesota reach state recycling goals; and WHEREAS, composting is a way of returning organic resources to the soil, conserving water during drought or flooding conditions, decreasing erosion, reducing water consumption and non-point pollution, and decreasing the dependence on chemical fertilizers; and WHEREAS, materials such as food scraps, compostable paper, and yard waste from St. Louis Park have all been composted and converted into a beneficial product known as compost; and WHEREAS, local governments, highway departments, soil conservation service and extension offices, and public works professionals can have significant impact on clean water, soil, and climate change by using compost for public works projects; and WHEREAS, composting creates green jobs and infrastructure for cities and states who implement composting programs; and WHEREAS, International Compost Awareness Week is a publicity and education initiative to showcase compost production and demonstrate compost use; and WHEREAS, this year’s theme “Compost! Healthy Soil, Healthy Food” was selected to highlight the importance of compost in clean, plentiful water and healthy soil. NOW THEREFORE, let it be known that the City of St. Louis Park, in recognition of the efforts of the US Composting Council, the Minnesota Composting Council, soil conservation stewards, residents, landscapers, farmers, recyclers, public workers, composters, gardeners, and plant growers everywhere, does hereby proclaim the week of May 7-13, 2017, as International Compost Awareness Week. WHEREFORE, I set my hand and cause the Great Seal of the City of St. Louis Park to be affixed this 17th day of April, 2017. _________________________________ Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2e EXECUTIVE SUMMARY TITLE: 3rd Annual SLP Earth Day Proclamation RECOMMENDED ACTION: The Mayor is asked to read and present the proclamation to SLP SEEDS organization members: Curtis Wilson, Executive Director, Nina Bacaner, Board President, and Sharon Lehrman, member of SEEDS’ Cooking Matters Advisory Board, MAND (MN Academy of Nutrition and Dietetics), as well as Health in the Park Better Eating Champion. POLICY CONSIDERATION: None at this time. BACKGROUND: SLP SEEDS, a nonprofit organization supporting wellness and resiliency in St. Louis Park, joins with the Environment and Sustainability Commission: Sustainable SLP to host the 3rd Annual SLP Earth Day Celebration on April 25th, 2017 at Lenox Community Center beginning at 5:30 pm. All citizens in our community are invited to join the free community dinner and town visioning forum. The keynote speaker, Mary Jo Kreitzer from the UMN’s Center for Spirituality and Healing, will set the tone and our guests from MN Food Charter, Alliance for Sustainability (Minneapolis) will help facilitate a dialogue adherent to SLP’s Vision 3.0 process. High school groups Roots n’ Shoots and the Bird Feeder program will also be on hand to help out. FINANCIAL OR BUDGET CONSIDERATION: Not applicable. VISION CONSIDERATION: St. Louis Park is committed to being a leader in environmental stewardship. We will increase environmental consciousness and responsibility in all areas of city business. SUPPORTING DOCUMENTS: Proclamation Prepared by: Debbie Fischer, Administrative Services Office Assistant Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 2e) Page 2 Title: 3rd Annual SLP Earth Day Proclamation PROCLAMATION 3nd Annual SLP Earth Day Community Dinner & Town Visioning Forum WHEREAS, SLP SEEDS, a nonprofit supporting wellness and resiliency in the Park, is hosting the 3rd Annual SLP Earth Day celebration on April 25th, 2017 at Lenox Community Center; and WHEREAS, Community Dinners provide a gathering for citizens of all ages and across cultures coming to the table to discuss concerns, wishes and recommendations from the general public to city and district officials and administration; and, WHEREAS, Community Forums provide a place to envision the future and voice goals; and WHEREAS, SLP SEEDS actively challenges and supports individuals, businesses, schools and community organizations to pledge to increasing efforts and actions of sustainable and wellness practices and policies; and WHEREAS, SLP SEEDS actively involves Roots N Shoots High School Environmental Club youth on their boards, and as interns, providing work experience, community service hours, vocational skills, and engaging youth in making a difference in their communities, preparing our next generation of environmentally responsible leaders. WHEREAS, SLP SEEDS support the efforts and actions of wellness and resiliency initiatives for all St. Louis Park peoples, land, water and community culminating in an action task list to reach towards in the coming year and years ahead; and NOW THEREFORE, let it be known that the Mayor and City Council of the City of St. Louis Park do hereby proclaim April 25th, 2017 to be the 3rd Annual SLP Earth Day and call upon all citizens in our Community to join the free community dinner and town forum visioning. WHEREFORE, I set my hand and cause the Great Seal of the City of St. Louis Park to be affixed this 17th day of April, 2017. _________________________________ Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Presentation: 2f EXECUTIVE SUMMARY TITLE: Recognition of Donations RECOMMENDED ACTION: Mayor to announce and express thanks and appreciation for the following donations being accepted at the meeting and listed on the Consent Agenda: From Amount For Minneapolis Auto Club Foundation $1,000 Annual Safety Camp Program T-shirts Becky Finnigan $1,000 Park maintenance and enhancements at Westwood Hills Nature Center MN Government Finance Officers Association Scholarship up to $2,300 Travel and conference registration for CFO Tim Simon to attend the 2017 Advanced Government Finance Institute on July 30 – August 4, 2017 in Madison, WI. Prepared by: Debbie Fischer, Administrative Services Office Assistant Approved by: Tom Harmening, City Manager Meeting: City Council Meeting Date: April 17, 2017 Minutes: 3a UNOFFICIAL MINUTES CITY COUNCIL SPECIAL STUDY SESSION ST. LOUIS PARK, MINNESOTA MARCH 20, 2017 The meeting convened at 6:00 p.m. Councilmembers present: Mayor Jake Spano, Tim Brausen, Steve Hallfin, Gregg Lindberg, Anne Mavity, Thom Miller, and Susan Sanger. Staff present: City Manager (Mr. Harmening), Deputy City Manager/Human Resources Director (Ms. Deno), Communications Manager (Ms. Larson), and Recording Secretary (Ms. Pappas). Guest: Gordon Goodwin, Consultant, Center for Social Inclusion. 1. Advancing Race Equity Ms. Deno stated that on January 26 and 27, 2017, the council participated in their annual workshop. The majority of the January 27 meeting involved conversation on advancing racial equity and putting ideas into action. On February 13, 2017, the council had a follow up discussion on next steps for advancing race equity action items. Ms. Deno introduced Mr. Goodwin, a consultant from the Center for Social Inclusion, who will facilitate the discussion. Mr. Goodwin noted that he will focus on further defining action for measurable steps #3 and #4 noted in the council report, with particular attention focused on providing guidance to the Human Rights Commission (HRC) as follow-up to the January joint meeting between the HRC and council. Councilmembers noted items that were still on their minds related to the workshop discussion and the HRC and MAC joint meeting. Mayor Spano stated there was a lot of energy from the HRC and MAC, although the council is not sure what the commissions should work on. He added there was also a sense there were some assumptions about where the council stands on these issues and how serious our commitment is to race equity. Councilmember Miller stated the council communicated to the commissions that it had not done a good job at the previous meeting and had not aligned with them earlier. He noted that Councilmember Brausen and others apologized to the commissions. Councilmember Lindberg stated he understood a need for the council to do a better job communicating and setting expectations. He stated there needs to be a mutual understanding in order to make a difference in areas that matter with residents. Councilmember Sanger recalled thinking the council is not proactive and seems passive in coming up with ideas on what to do. She added there is no clear idea of what the standard would be to achieve race equity. City Council Meeting of April 17, 2017 (Item No. 3a) Page 2 Title: Special Study Session Minutes of March 20, 2017 Mr. Goodwin asked the council what the charge is. Councilmember Mavity stated the charge is for the commission to advise the council, adding that her expectation of the HRC is for them to be free to do programs and have conversations. She stated there have been tensions, and she felt the commissions may be hemmed in vs. released to do their work. Mr. Goodwin stated that in terms of work at the city, there has been much internal work done at the department level. He noted teams and leadership have been deployed to work on race equity. He stated work is being done to normalize and operationalize systems and structures to work for people of color as well as they work for white people. He added there is broader communication with the community; however, there is still room for more conversations in order to convey why this is so important. He added the HRC has their own charge, and a fair amount of autonomy, but added they are looking to the council for direction on how they can be engaged in moving this conversation forward. They want to know if there is a fact-finding mission the council wants to send them on. Mayor Spano stated the HRC, MAC, Allies of St. Louis Park, the council, and the school district are all working on this in the city. He added that moving forward, these entities will need to communicate with one another so as not to duplicate efforts or run into conflict with one another. Councilmember Mavity noted that the commission is not a replacement for the council. She stated she does not want the council to delegate everything to the HRC. She asked if they are being effective and reaching all the people in St. Louis Park that council wants to reach through their efforts. Councilmember Brausen added the HRC is looking for direction or tasks they can do, and the council has to give them this direction. He stated the council needs to decide what they want to do for community events and then get the HRC involved. He reiterated that the council needs to provide the HRC with guidance. Councilmember Hallfin disagreed with Councilmember Brausen on this point, stating the commission has its own charge, and the council should not guide them. Councilmember Brausen stated the council does have specific things for the HRC to do, adding the council and HRC need to have a major conversation regarding race equity, and then commission them to help. Councilmember Hallfin again disagreed. Mr. Goodwin tried to give clarity here, stating there may be an opportunity for the council to host an event or to co-host one with the HRC. Councilmember Sanger stated she thinks over the years the HRC has ebbed and flowed. There have been times when they have been proactive, worked on projects, and reported back to the council. Then other times they were not working on any projects. She asked what the differences in those time periods were. Mr. Goodwin asked what role the council wants to play in the conversation. Councilmember Lindberg stated the council needs to play a strong role and needs to lead those conversations. He added he is not sure what this looks like but noted it is part of the tension between the HRC, the council, and the MAC which led to misinformation and miscommunication. City Council Meeting of April 17, 2017 (Item No. 3a) Page 3 Title: Special Study Session Minutes of March 20, 2017 Councilmember Hallfin added that if the council leads, we are putting the HRC in the back seat again, especially if the councilmembers participate in the conversation as council members, and not as community members. He added if the council leads this, people will look more to us than to the HRC. Mayor Spano disagreed, stating he has been involved in conversations where he participated and was not viewed as the Mayor or as a councilmember. Councilmember Miller stated the council could come up with the race equity plan and task the HRC with handling the community conversation. Then council can take the necessary next steps. Councilmember Brausen agreed the HRC can play a role in this, but the council should develop the bigger frame for this community conversation. Councilmember Mavity stated the council can set goals, task the HRC to organize the community conversations, and review every three months. Goals can be set regarding raising up new community leaders, as well. Mr. Goodwin stated this could be part of the HRC charge - to set a timeframe and some success measures, with goals and targets for the community engagement sessions. Councilmember Sanger added that since the HRC is looking for specific tasks, one might be to reach into communities that we have historically not been able to reach; tapping into leadership; and finding out what the best ways are to communicate with them. Councilmember Lindberg added strategies can be added for doing this. Mayor Spano, however, noted the reality is that it is conceivable that despite best efforts, the city may not penetrate a particular community. Mayor Spano added he would like to see the HRC and MAC produce some analysis on what strategies are used in other communities to get people engaged and communicating. He added right now he is talking to one person at a time. Councilmember Mavity agreed with the Mayor, stating we can invite people but cannot compel them to participate. She added the idea is to flip this on its head and reach out to engage all people in our community, not only people of color. She added the Allies are doing this, with book clubs and by being welcoming and open. Councilmember Mavity stated the council does not need to be over prescriptive, adding they should let the HRC take the conversation to the community and in April focus on goals to address race equity in the parks, in police, in housing and in other areas. They would be asking for input on effective policies to advance race equity. Councilmember Sanger added ultimately the council is responsible for policies and how city resources are allocated. The question is what should be taken into consideration when we develop policies. Councilmember Brausen stated these are bigger conversations, but it falls upon the council to guide and develop policy around race equity. Mayor Spano added most discussion points fall into policy and outreach, and it would be reasonable to have the MAC look at policies, do some research and report back to the council. Community outreach can be included, along with helping to get more people groups to meetings City Council Meeting of April 17, 2017 (Item No. 3a) Page 4 Title: Special Study Session Minutes of March 20, 2017 to have these courageous conversations. He added the council can help the conversation but added he does not want to write a work plan for the HRC. Councilmember Sanger disagreed with Mayor Spano, noting she is not sure the council should have the HRC or MAC do research on policies. She added the council should do the research, present the data, and then have HRC give recommendations. Mayor Spano noted HRC could work with staff. Councilmember Sanger agreed. She added this same structure could be used with other commissions, also. Mr. Goodwin stated this idea suggests accountability, adding that the commissions are instruments of the council to make recommendations, while the council makes policy. Councilmember Mavity added that the roles of the council, the commissions and the staff need to all be clarified. Mayor Spano felt it would be valuable to have the commissions and council go through courageous conversations, both internally and externally. He stated that race equity is a very intimate and personal topic, and it is extremely motivational. Mr. Goodwin added that the League of Minnesota Cities might also be interested. Councilmember Mavity stated a proposal should be written by the council and then reviewed with the commissions. Mr. Goodwin noted community engagement forums, hosted by the HRC within a specific timeframe, could be useful. Mayor Spano added he does not want to wait, stating the council needs to come up with a framework of how the commissions will assist on race equity. Mr. Goodwin stated he will frame the scope of duties and obligations with a time frame for the council and for the HRC, noting the items HRC will do with the council and on the council’s behalf. The meeting adjourned at 7:15 p.m. ______________________________________ ______________________________________ Melissa Kennedy, City Clerk Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Minutes: 3b UNOFFICIAL MINUTES CITY COUNCIL MEETING ST. LOUIS PARK, MINNESOTA MARCH 20, 2017 1. Call to Order Mayor Spano called the meeting to order at 7:34 p.m. Councilmembers present: Mayor Jake Spano, Tim Brausen, Steve Hallfin, Gregg Lindberg, Anne Mavity, Thom Miller, and Susan Sanger. Councilmembers absent: None. Staff present: City Manager (Mr. Harmening), City Attorney (Mr. Mattick), Deputy City Manager/Human Resources Director (Ms. Deno), Director of Community Development (Mr. Locke), City Clerk (Ms. Kennedy), Planner (Ms. Monson), Police Chief (Mr. Harcey), Fire Chief (Mr. Koering), Communications Manager (Ms. Larson), Senior Planner (Mr. Walther), and Recording Secretary (Ms. Pappas). Guests: St. Louis Park Police Department members; family members of Mike Harcey. 1a. Pledge of Allegiance 1b. Roll Call 2. Presentations 2a. Recognition of Donation Mayor Spano thanked the MN Society of Arboriculture for their donation of $2,500 for expenses for Jim Vaughan, Natural Resources Coordinator, to attend an educational conference in Washington, DC recently. 3. Approval of Minutes 3a. Special Study Session Minutes February 13, 2017 Councilmember Sanger noted a change at the bottom of page 5. It should read “Councilmember Sanger stated the developer has done an admirable job in including every possible politically correct entity in the project.” Councilmember Sanger also noted she was referring to the north frontage road on Highway 7, and not the north side of Wooddale. Finally, she stated it should also reflect she was quite concerned because the estimated costs of the construction project are twice as high as the estimated market value of the project, upon completion, so this did not seem like a good financial investment. City Council Meeting of April 17, 2017 (Item No. 3b) Page 2 Title: City Council Meeting Minutes of March 20, 2017 It was moved by Councilmember Brausen, seconded by Councilmember Hallfin, to approve the February 13, 2017 Special Study Session Meeting Minutes as amended. The motion passed 7-0. 3b. Special Study Session Meeting Minutes March 6, 2017 Councilmember Sanger noted the correct spelling of Laura Silverfarb’s last name as “Silverfarb” and not “Silverfarber”. Additionally, she noted limiting sales to tobacco-only shops and raising the minimum age to 21, are the neater and cleaner solutions. She stated she did not support establishing a minimum price for these products. It was moved by Councilmember Brausen, seconded by Councilmember Hallfin, to approve the March 6, 2017 Special Study Session Meeting Minutes as amended. The motion passed 7-0. 3c. City Council Meeting Minutes March 6, 2017 It was moved by Councilmember Lindberg, seconded by Councilmember Mavity, to approve the March 6, 2017 City Council Meeting Minutes as presented. The motion passed 7-0. 3d. Joint Meeting Minutes March 13, 2017 It was moved by Councilmember Mavity, seconded by Councilmember Brausen, to approve the March 13, 2017 Joint Meeting Minutes as presented. The motion passed 7-0. 4. Approval of Agenda and Items on Consent Calendar 4a. Approve Second Reading and Adopt Ordinance No. 2514-17 amending Chapter 36 of the St. Louis Park Code of Ordinances relating to zoning to permit dwelling units as an accessory use to religious institutions located in the residential zoning districts, and to approve the ordinance summary for publication. 4b. Adopt Resolution No. 17-052 approving Fourth Amendment to Contract for Private Redevelopment with Central Park West, LLC. 4c. Adopt Resolution No. 17-053 approving acceptance of a monetary donation from the Minnesota Society of Arboriculture in an amount not to exceed $2,500 for all related expenses for Jim Vaughan, Natural Resources Coordinator, to attend the 2017 International Society of Arboriculture Conference in Washington, D.C. 4d. Approve a Temporary On-Sale Intoxicating Liquor License for Church of the Holy Family at 5900 West Lake Street for their Parish Spring Dinner to be held April 22, 2017. 4e. Designate California Skate Parks as the authorized bidder and authorize execution of a contract with the firm in the amount not to exceed $200,000 to design and build the skate park to be located in Carpenter Park. City Council Meeting of April 17, 2017 (Item No. 3b) Page 3 Title: City Council Meeting Minutes of March 20, 2017 4f. Adopt Resolution No. 17-054 of Support for Sela Group’s submission of a grant application to the Hennepin County Transit Oriented Development (TOD) Program for its Parkway 25 project. 4g. Approve stipulation and agreement regarding revocation of liquor license issued to Thanhdo, Inc. by the City of St. Louis Park. It was moved by Councilmember Brausen, seconded by Councilmember Lindberg, to approve the Agenda as presented and to waive reading of all resolutions and ordinances. The motion passed 7-0. 5. Boards and Commissions - None 6. Public Hearings 6a. GC 8028, LLC dba KAI & Little Crustacean – On Sale Intoxicating and On- Sale Sunday Liquor License. Ms. Kennedy presented the staff report. She noted the city received an application from the applicant for an On-Sale Intoxicating and On-Sale Sunday liquor license for the property located at 8028 Minnetonka Blvd. The main principal is Heidi Pham and the on-site manager is Seth Russell. Ms. Pham purchased Thanh Do, the restaurant previously located on the premises, to open KAI & Little Crustacean. The Police Department did a full background investigation on both Ms. Pham and Mr. Russell, nothing was found that would prevent Ms. Pham from obtaining a license. Likewise, the City Attorney reviewed the application and investigation materials and did not find anything precluding the owner from obtaining a liquor license. Mayor Spano opened the public hearing. No speakers were present. Mayor Spano closed the public hearing. Councilmember Lindberg asked for clarification and if this issue is related to the last item on tonight’s consent agenda. Ms. Kennedy stated this is a separate issue. Councilmember Brausen noted that on the consent agenda, the ThanDo liquor license was revoked. He asked if KAI & Little Crustacean is a separate business which has now opened at this location. Ms. Kennedy confirmed that it is. Councilmember Hallfin asked if the new owner is related to the former owner of Than Do. Ms. Kennedy stated Ms. Pham and Mr. Pham are unmarried domestic partners. It was moved by Councilmember Lindberg, seconded by Councilmember Miller, to approve application from GC 8028, LLC dba KAI & Little Crustacean for an On-Sale Intoxicating and On-Sale Sunday Liquor License for the premises located at 8028 Minnetonka Boulevard with a license term through March 1, 2018. The motion passed 7-0. 7. Requests, Petitions, and Communications from the Public – None City Council Meeting of April 17, 2017 (Item No. 3b) Page 4 Title: City Council Meeting Minutes of March 20, 2017 8. Resolutions, Ordinances, Motions and Discussion Items 8a. Resolution Confirming Appointment of Michael Harcey to Police Chief. Resolution No. 17-055 Mr. Harmening presented new St. Louis Park Police Chief Mike Harcey to the citizens of the city. He noted that Mr. Harcey has his master’s degree, has been with the St. Louis Park Police Department for 25 years, and has worked his way up the ranks of the department. Mr. Harmening added that during the recruitment process, Mr. Harcey did extremely well among the applicants from around the country. He added Mr. Harcey is humble and effective, with a listening, calm, and collaborative disposition. Mr. Harmening stated Mr. Harcey is very dedicated to the City of St. Louis Park, the Police Department, and has been instrumental in the positive transition into his new role. Mr. Harmening stated Mr. Harcey is the right person at the right time for St. Louis Park, and he recommends his appointment as the next Police Chief. Councilmember Brausen stated he was asked during this process about local candidates and noted that Mr. Harmening did a national search, recognizing this was the single most important hire he would make for a long time. He continued by saying that ultimately Mr. Harmening found an internal candidate, and with a thorough and thoughtful process, has recommended Mike Harcey as the new chief. Councilmember Brausen stated he is excited about this appointment. Councilmember Mavity agreed, adding that her dad was a police officer, so she can understand and appreciate the sacrifices of Mr. Harcey’s family. She added this has been an excellent process every step of the way, and the policing done in St. Louis Park reflects the values of the city. She welcomed the new chief and offered her congratulations. Mayor Spano also thanked Mr. Harmening for his work on this very big decision, stating that he imagines former Police Chief Luse would be proud to know one of his guys is the new chief. It was moved by Councilmember Sanger, seconded by Councilmember Mavity, to adopt Resolution No. 17-055, confirming the appointment of Michael Harcey to the position of Police Chief. The motion passed 7-0. Ms. Kennedy administered the oath of office to Chief Harcey. Chief Harcey stated it has been an honor to serve the City of St. Louis Park for the last 25 years and thanked his wife and daughters for their support, adding he is humbled to be selected as the new chief. He stated that he appreciated everyone in attendance at the meeting and thanked everyone for their support. 8b. Call for Public Hearing to Consider Establishment of the Wooddale Station TIF District. Resolution No. 17-056 Mr. Hunt referred to the staff report, stating he had nothing further to add. City Council Meeting of April 17, 2017 (Item No. 3b) Page 5 Title: City Council Meeting Minutes of March 20, 2017 It was moved by Councilmember Mavity, seconded by Councilmember Miller, to adopt Resolution No. 17-056, calling for a public hearing on May 1, 2017 relative to the establishment of the Wooddale Station Tax Increment Financing District within Redevelopment Project No. 1. The motion passed 6-1 (Councilmember Sanger opposed). 8c. PLACE Private Activity Revenue Bond Financing (Housing). Resolution No. 17-057 Mr. Simon presented the staff report calling for the public hearing on April 17, 2017. He noted the council is being asked to consider the issuance of private activity revenue bonds to finance all or a portion of the proposed 299 housing units in the project in the approximate principal amount up to $27,185,503. Councilmember Mavity stated that the March 13, 2017, staff report on PLACE provided an in-depth report and demonstrates this is a complex project, with financial gaps. She continued that the city will need to find a way to fill these gaps. The city has invested over four years on this project, and it is in all of our best interests to do everything to help move this project forward at no risk. It was moved by Councilmember Mavity, seconded by Councilmember Lindberg, to adopt Resolution No. 17-057, calling for a public hearing regarding the issuance of revenue bonds for the benefit of PLACE, or affiliated thereof, and a multifamily housing program. The motion passed 6 -1 (Councilmember Sanger opposed). 8d. Douglas Corporation – Conditional Use Permit. Resolution No. 17-058 Ms. Monson presented the staff report. She noted that Douglas Corporation applied for a CUP for the property at 3520 Xenwood Avenue to allow excavation of more than 400 cubic yards of soil. The plan is to excavate 2,150 cubic yards in order to install two underground detention tanks to collect rainwater, which will be captured from the roof, stored in buried tanks, and then pumped into the facility for treatment and reuse in the industrial process. She added that the Minnesota Pollution Control Agency (MPCA) determined that Douglas Corporation was the source of pollution contaminating Lake Calhoun. Prior to 2010, the company used chemicals in the manufacturing process that contaminated the stormwater on the site. Once the company realized their potential harm, they ceased using the products and found alternatives; however the chemicals accumulated on the roof. Since 2010, Douglas Corporation has worked with the MPCA to replace the roof, roof vents, tanks and other structures, but there are still traces of pollution on the property which are contaminating the stormwater runoff. The company’s goal is to stop the stormwater contamination by capturing runoff from the property before it leaves the site; filtering and treating the water; and reusing the water in its industrial process. Today the site does not meet zoning regulations; however, the proposed plans bring the site closer to compliance to the extent possible. Ms. Monson stated a neighborhood meeting was held on February 28, 2017, which no one from the community attended. She added that the Planning Commission voted 4-0 to recommend the CUP for Douglas Corporation to council. City Council Meeting of April 17, 2017 (Item No. 3b) Page 6 Title: City Council Meeting Minutes of March 20, 2017 Councilmember Brausen stated he is supportive of allowing the owners to address this issue and asked how many people work at Douglas Corporation. John Fudala, Douglas Corporation Operations Manager, stated 135 employees work at the facility, and a total of 600 employees work within the metro area. Councilmember Brausen asked what chemicals are being put into the stormwater. Mr. Fudala stated PCP’s, which are harsh chemicals and so unstable that they are of concern. Councilmember Brausen asked if there has been any impact on ground water. Mr. Fudala stated that there has been an impact on the shallow ground water, but not in the bedrock. Councilmember Sanger stated she is supportive but asked if this fully resolves the problem, and if not, what else Douglas Corporation will do about it. Mr. Fudala stated they have replaced the roof and every piece of plumbing that was touched by the contaminants. He added they stopped using the material in 2010 as soon as it was discovered. The only way to eliminate the problem is to treat the water. Councilmember Sanger asked Mr. Fudala if the corporation will be in full compliance. Mr. Fudala answered yes. Councilmember Mavity stated the Elmwood Neighborhood has been hit hard with these types of issues, and she appreciates the changes and improvements that Douglas Corporation is making. She thanked Mr. Fudala for doing this work. Councilmember Brausen also thanked Mr. Fudala, adding this is probably very expensive. Mr. Fudala stated yes, it is. Mayor Spano asked if there will be any traffic impacts as the trucks haul during the excavation. Ms. Monson stated it will not be too impactful. It was moved by Councilmember Mavity, seconded by Councilmember Brausen, to adopt Resolution No. 17-058 granting a Conditional Use Permit (CUP) for Douglas Corporation allowing the excavation of 2,150 cubic yards of material to construct an underground stormwater, capture and reuse system at 3520 Xenwood Avenue, subject to conditions. The motion passed 7-0. 8e. The Elmwood – Alley Vacation, Preliminary and Final Planned Unit Development. Ordinance Nos. 2515-17 and 2516-17 Ms. Monson presented the staff report. She noted the development is mixed use, has 85 units, and 20% of the units are affordable at 60% area median income. She stated at the November 29, 2016, neighborhood meeting, there were concerns about parking and building façade meeting zoning requirements and that the proposed parking and façade materials exceed the base zoning requirements; however, no comments were made by the public at the Planning Commission meeting. Councilmember Mavity stated this project has been discussed in the past at several study sessions and neighborhood meetings. City Council Meeting of April 17, 2017 (Item No. 3b) Page 7 Title: City Council Meeting Minutes of March 20, 2017 It was moved by Councilmember Mavity, seconded by Councilmember Brausen, to approve Second Reading and Adopt Ordinance No. 2515-17 vacating the northern eight feet of alley right-of-way and approve the Summary Ordinance for publication. The motion passed 6-1 (Councilmember Miller opposed). It was moved by Councilmember Mavity, seconded by Councilmember Brausen, to approve Second Reading and Adopt Ordinance No. 2516-17 adding Section 36-268-PUD 8 of the Zoning Code and amending the Zoning Map from IP-Industrial Park to PUD 8 for the property located at 5605-36th Street West and approve the Summary Ordinance for publication. Councilmember Lindberg noted that the last time this PUD came before the council, he supported the alley vacation but did not support the PUD. However, since that time, he has further reviewed the PUD. He stated he has been a tireless advocate for senior housing and noted a conversation recently with his mother, who would be able to afford the rents that will be offered at this development. He stated he does not want to be an enemy of good. Therefore, he will be changing his position and will not stand in the way of the project accomplishing its goals. Councilmember Brausen stated he is supportive of this project, also. The motion passed 6-1 (Councilmember Miller opposed). 9. Communications Mr. Harmening noted the upcoming State of the City address on Thursday at 4:30 p.m. at the non–profit site, Matter, located at 7005 Oxford Street. Councilmember Brausen commented on the STEP fundraiser, where he served soup last week, and hoped it was successful this year. Councilmember Hallfin added this year they raised close to $30,000 vs. last year when $20,000 was raised. This year they ran out of all the soup and had bigger crowds. He thanked all for coming out and supporting this event. 10. Adjournment The meeting adjourned at 8:20 p.m. ______________________________________ ______________________________________ Melissa Kennedy, City Clerk Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Minutes: 3c UNOFFICIAL MINUTES CITY COUNCIL SPECIAL STUDY SESSION ST. LOUIS PARK, MINNESOTA April 3, 2017 The meeting convened at 6:00 p.m. Councilmembers present: Mayor Jake Spano, Tim Brausen, Steve Hallfin, Gregg Lindberg, Anne Mavity, Thom Miller, and Susan Sanger. Staff present: City Manager (Mr. Harmening); Director of Inspections (Mr. Hoffman); Economic Development Coordinator (Mr. Hunt); Chief Financial Officer (Mr. Simon); Director of Community Development (Mr. Locke); and Recording Secretary (Ms. Pappas). Guest: Cindy Nagel, KOMA; Stacie Kvilvang and James Lenhoff, Ehlers. 1. Council Chambers Remodel Update Mr. Hoffman presented the report with Ms. Nagel. Ms. Nagel showed the most recent concept drawings of the Council Chambers remodel. On November 28, 2016, council was presented with the first round of drawings and a cost analysis for remodeling options of council chambers. Direction was provided to staff at that time on plans for re-orientation of the room layout; installation of large exterior windows; addition of a glass wall adjoining the lobby; monitors and media elements; and other design criteria. Ms. Nagel pointed out four large monitors on the east side of the room, which would form a large video wall for the audience to view. Additionally, she noted there would be another monitor on the southwest corner of the room, above the council dais area. She also pointed out the east wall; the single exit door; the storage room; and the podium at front, which would also have a monitor attached. The podium would be mobile and able to face either the audience or the council. Ms. Nagel noted this would provide flexibility when presenting. Councilmember Brausen asked if there would be an overhead document camera included. Mr. Hoffman stated that has not been determined yet, and most presentations would be shown through the projector and monitors. Councilmember Sanger stated she thought there would be one small monitor in front of each council chair, asking why that plan had changed. Mr. Hoffman stated that from previous discussions, it was understood that the monitors would block the council from the audience, so the podium monitor was created as an alternative. Councilmember Mavity stated the height of the monitor on the podium is not ideal, asking if the dais might be raised higher; however, adding this might feel like a block between the council and audience. Mr. Harmening stated the goal is to keep the council at the floor height as it exists today, and to keep the dais structure light, and not heavy looking nor intimidating. Mr. Hoffman added they did discuss putting a monitor on the ceiling; however, felt it was too low and would be difficult to look up during a presentation. He stated staff felt the council would be City Council Meeting of April 17, 2017 (Item No. 3c) Page 2 Title: Special Study Session Minutes of April 3, 2017 bringing in their own laptops or iPads to use, as well, and there was concern that monitors on the dais would cause cluttering. Mayor Spano asked if there was a way to have the microphones rise out of the desktop, so as to create more space on the dais. Ms. Nagel stated she would research that. Councilmember Sanger asked about the distance from the dais to the back of the room, asking if it would be difficult for people in the back to see the monitors, and another one halfway down would be needed. Mr. Hoffman stated the video wall is extremely large, and most people could turn their head and view with no obstructed view. Councilmember Brausen asked if chairs will be on wheels so audience members can pivot easily. Mr. Hoffman stated there will be new chairs but typically there are no wheels on them, as they would be difficult to keep in place. Councilmember Lindberg asked about the raised portion of the staff desk, noting it looks too close to the dais in that position. Mr. Hoffman stated it is moveable and so can be moved, depending on what kind of meeting is taking place. Mr. Hoffman added that the new design creates more floor space and allows for 100 seats in the chamber audience. Ms. Nagle pointed out the room finishes and carpet tiles. Mr. Hoffman noted the carpet company is environmentally-friendly and will take out the worn tiles and recycle them. Ms. Nagel pointed out the elegant finishes of wood, some green or neutral colors, a white ceiling and some soffits. She suggested the white based dais for a lighter feel and less distraction as the council is filmed, noting the LED lighting will give the dais a glow. She added the logo will be similar to the one on 3rd floor and would be added to the wall behind the council. Councilmember Hallfin stated he would like both the St. Louis Park name and logo on the wall behind the dais, along with acoustical wood panels. He added he does not like the white stone on the back wall. Councilmember Miller asked if the perforated wood is costly. Mr. Hoffman stated it is somewhat, but is needed for acoustics. Mayor Spano added he would also like to see the logo on the wall behind the council but offset to one side or the other, adding he would also appreciate some asymmetrical shapes and creative designs for accent. Mayor Spano added that when he visited the University Of Kansas School Of Architecture, they had a fully green back wall, which he liked. He would like the designers to consider this, also. Councilmember Sanger asked about the glass doors as a security measure. She noted that the report also mentions a feature where the glass turns opaque and asked if this would be needed and how costly it would be. Mr. Hoffman stated it can be clear glass, but when the room is used for training, the opaque feature could be implemented to give privacy in the chambers from the lobby. Mayor Spano asked Mr. Hoffman to explain the security measures to the council. Mr. Hoffman stated the only public entrance into Council Chambers will be through the double glass doors in the lobby. There will also be the back exit door with no window, which can be used for access into the room using a fob. There will be panic buttons in the dais for the council, and a live security City Council Meeting of April 17, 2017 (Item No. 3c) Page 3 Title: Special Study Session Minutes of April 3, 2017 feed will show at the Police Department. The plan is for councilmembers to duck and cover behind the dais if there is a need to get out of harm’s way. Mayor Spano stated it would be a mistake if there is not a safe room or way for the council members to escape the room. When speaking with several other local mayors, he received recommendations to have a police officer in the chambers for all council meetings. Mr. Harmening agreed that some councils have a uniformed or plain clothes police officer at each meeting. He added the council should remember this is being built for councilmembers in the future, also, so it is good to discuss this topic. Mayor Spano added that the security measures will be worth the cost. Mr. Hoffman stated that the creation of a safe room with a ballistic door and concrete wall, which could also be used as a storm shelter, would cost approximately $30-40,000. Councilmember Mavity asked if a safe room is actually effective and if it has worked for any other councils before. Councilmember Lindberg stated he now believes staff should look further into this option. Councilmember Miller stated he would prefer to have the police officer in the room, for the protection of the council, but also for all the other people in the room, and to make sure the public is aware of this arrangement. He added this might be a deterrent to anyone with an idea of coming to do harm. Mayor Spano agreed. Councilmember Mavity asked about the 6 inches on the raised dais, wanting to be sure there is good visibility from the audience to the council. She also asked if that is what is in place currently. Ms. Nagel said yes. Mayor Spano added that he again would like to be certain the step up from the floor to the dais is clearly a different color, in order to assist visually impaired people. Ms. Nagel stated yes, this, will be a clearly different color, with cherry wood all the way around the step Mr. Hoffman stated the completion of the plans over the next 4-6 weeks will be important in providing time to secure contractor quotes and order products. He stated that based on this, the project is expected to begin during June or July 2017. The construction duration will be approximately 3-4 months. He added that staff will report back to council in a few weeks. Councilmember Mavity suggested the wall of mayors should possibly be moved, especially in light of all the race equity work being done in the city. Mayor Spano stated that when he talks with school children, he does point this fact out and note there is work being done to bring change. 2. PLACE’s Application for Tax Increment Financing (TIF) Assistance Mr. Hunt explained the PLACE application for TIF assistance. He noted that the total development cost for PLACE is estimated at $123 million, noting this amount is not financially feasible for the developer. Therefore, the developer is asking for $5.66 million in tax increment assistance. It is necessary to offset a portion of the project’s $9.5 million in extraordinary site preparation costs. It is proposed that the EDA enter into a purchase and redevelopment contract with PLACE under which the developer agrees to acquire the assembled redevelopment site from the City/EDA for $6.457 million; to construct the project as proposed; and to be reimbursed for qualified site City Council Meeting of April 17, 2017 (Item No. 3c) Page 4 Title: Special Study Session Minutes of April 3, 2017 improvement costs up to $5.6 million in a pay-as-you -go tax increment note over a term of 15 years. The proposed TIF assistance would bring the housing portion of the project closer to financial feasibility; however, PLACE has significant work remaining relative to cost refinement, financing, fundraising and securing of equity partners before the project can proceed. Councilmember Mavity stated that the fact that the city will be gaining affordable units and also comparing this development to investments in other projects, she believes there would be no financial risk to the city, adding there is no reason not to approve the TIF assistance. Councilmember Hallfin asked about the parcels of land involved. Mr. Hunt stated the EDA will act on a total of 9 parcels this evening, for the PLACE project. Councilmember Hallfin requested confirmation that the city will own all the parcels and then sell them to PLACE, asking when the city will get paid. Mr. Hunt stated that is correct; however, the city will not close on this transaction until PLACE has all the financing in place. He added that once the developer builds the project and the tax increment begins, then they will start paying the city. Mr. Locke stated that the EDA/City will receive the bulk of the purchase price for the land, $4.745 million at the closing. The rest of the purchase price, $1.5 million, PLACE will pay over time. The funds the EDA/City receive at closing will cover what the EDA/City has spent to date for the parcels purchased by the EDA/City for sale to the developer. Councilmember Miller asked if all parcels are tax exempt. Mr. Hunt stated yes, they all are now. Councilmember Brausen stated he is in favor of this TIF, adding this seems like a reasonable investment. Councilmember Sanger stated she is not going to support the TIF as she does not like the project. She questioned the use of tax payer money tied up in this project for a building that will be valued at half its cost and wondered what kind of research staff has done on how to use this money in a different fashion. She further asked what the city could do instead. Ms. Kvilvang from Ehlers stated for these types of bonds, there is limited use, adding the only thing they could be used for is 20% affordable housing, and specifically for this type of project. She added the development provides mixed use, affordable housing, and e-generation. Councilmember Sanger asked what will happen if the project is not successful in the long term and is not fully occupied, or if the hotel is not successful. Ms. Kvilvang stated there is no concern about this, adding that the property has an industry standard risk profile and vacancy profiles. Councilmember Sanger asked also about the Wooddale Bridge and if changes will be made to the bridge with or without the PLACE project moving forward. Mr. Locke stated Wooddale Bridge improvements are needed with or without the PLACE project. Councilmember Sanger disagreed and stated that Ms. Heiser had told her that some of the Wooddale improvements were needed specifically for the PLACE project. Councilmember Mavity stated whether or not it is the PLACE project which is developed here, the city certainly wants the former McGarvey Coffee property to be developed. Regardless of the development, the Wooddale Bridge will need to be updated. City Council Meeting of April 17, 2017 (Item No. 3c) Page 5 Title: Special Study Session Minutes of April 3, 2017 Councilmember Sanger stated the timing of this request is questionable. She added that by giving the TIF assistance now, it becomes a slippery slope to do tax financing before we actually look at the project itself. Mr. Locke stated the city always attempts to have zoning and planning running parallel with the TIF process. He added this is a complex project, and PLACE is in the process of getting all of its zoning approvals, adding there is nothing unusual about the timing here. Staff is not trying to fast track anything. Councilmember Sanger added that the Bridgewater project zoning approvals are coming to the City Council tonight in advance of consideration of TIF assistance. Mr. Locke stated that the Bridgewater project is a different situation. Councilmember Lindberg stated the developer deserves a lot of credit, and he appreciates the number of changes that have been made from what the project was and what it is today. He added staff deserves much credit for negotiating this project, adding there is no risk to our taxpayers. PLACE is a benefit to the community. He added this is a reasonable TIF request, and the project is reflective of our city’s values, with the environmental and affordable housing components. Mayor Spano stated every project is different in timing and financial needs, adding that this is a unique financial project and requires a different look and view. He stated the commitment is big, and the payoff will be big. It was the consensus of the council to move forward. Mr. Hunt stated this evening the EDA will be asked to approve the purchase agreement with Hennepin County for the remnant parcels needed for the PLACE project, and at the next the meeting, the council will see the terms of the actual PLACE redevelopment agreement. He added on May 1, 2017, the public hearing will be held for the TIF district, and the council will consider approval of the purchase agreement. The meeting adjourned at 7:15 p.m. ______________________________________ ______________________________________ Melissa Kennedy, City Clerk Jake Spano, Mayor Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4a EXECUTIVE SUMMARY TITLE: Temporary On-Sale Intoxicating Liquor License – Finnegans Community Fund RECOMMENDED ACTION: Motion to Approve a Temporary On-Sale Intoxicating Liquor License for Finnegans Community Fund at Gamble Drive and the adjacent privately owned parking lot in West End for May 20, 2017. POLICY CONSIDERATION: Is the application for the temporary license in compliance with the City’s ordinance requirements? BACKGROUND: Finnegans Community Fund has made application for a Temporary On-Sale Intoxicating Liquor License for the City Pages Annual Beer Festival to be held for the second year at the West End Festival Site on Saturday, May 20, from 4:30-9 p.m. The festival will include food vendors, beer sampling, and live entertainment. The applicant is working with Operations & Recreation staff to coordinate use of the site and details of the event, including obtaining the necessary approvals from the City Fire and Police Departments. There were no problems or issues at the 2016 event. Founded in 2000 in Minneapolis, Finnegans is a self-sustaining social business. Their mission is “to create sustainable change for those affected by hunger through profits from Finnegans Irish Amber and Finnegans Blonde Ale, and other innovative products and events. Through the Finnegans Community Fund (501c3), they turn profits from beer sales into food for the hungry. Ninety-eight percent of all funds that are donated to the Finnegans Community Fund go directly to alleviating hunger in local communities. In Minnesota, fresh produce is purchased from local farms and distributed to area food shelves through the The Food Group’s Harvest for the Hungry Program.” The Police Department has completed the background investigation on the principals of Finnegans Community Fund and has found no reason to deny the temporary license. The applicant has met all requirements for issuance of the license, and staff is recommending approval. FINANCIAL OR BUDGET CONSIDERATION: The fee for a temporary liquor license is $100 per day of the event. VISION CONSIDERATION: Not Applicable. SUPPORTING DOCUMENTS: None Prepared by: Kay Midura, Office Assistant – City Clerk’s Office Reviewed by: Melissa Kennedy, City Clerk Approved by: Tom Harmening, City Manager Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4b EXECUTIVE SUMMARY TITLE: Approve Amendment to Consultant Contract – W. 37th St. Bridge & Road Reconstruction (4017-1700) RECOMMENDED ACTION: Motion to authorize execution of an amendment to a professional services contract with WSB and Associates in the amount of $346,216 for the W. 37th Street Bridge and Road Reconstruction Project (Boone Ave. to Aquila Ave.) Project No. 4017-1700. POLICY CONSIDERATION: Does the City Council wish to continue to implement the city’s Pavement Management Program? SUMMARY: This summer, W. 37th Street will be reconstructed between Boone Avenue and Aquila Avenue, this includes the reconstruction of the bridge over Minnehaha Creek. The City hired WSB and Associates to design the new W. 37th Street Bridge. Given the magnitude of the City’s infrastructure projects this year, and in order to ensure that the project can be completed by this fall, staff recommends having the consultant complete the construction administration for this project. Staff further recommends using WSB for the construction administration because they are the designers of the project and have a comprehensive background on the project. WSB has successfully completed other work for the City in the past. This project is currently scheduled to be bid in May with a construction start of June. The project will be complete in November of 2017. FINANCIAL OR BUDGET CONSIDERATION: This project is included in the City’s Capital Improvement Program (CIP) for 2017. Funding will be provided by a combination of Federal Aid, Pavement Management funds, Utility funds, and General Obligation Bonds (Connect the Park). VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Discussion Location Map Prepared by: Joseph Shamla, Sr. Engineering Project Manager Reviewed by: Debra M. Heiser, Engineering Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4b) Page 2 Title: Approve Amendment to Consultant Contract – W. 37th Street Bridge & Road Reconstruction DISCUSSION BACKGROUND: In 2017, W. 37th Street and the bridge over Minnehaha Creek is being reconstructed. This bridge was inspected in 2011 and the inspection revealed the need for replacement. The existing bridge is a channel span bridge and is no longer recommended by MnDOT due to a history of structural and maintenance issues. A pedestrian connection is provided on a separate bridge to the north of the vehicle bridge. Both of these bridges will be removed and will be replaced with a new bridge wide enough to accommodate sidewalk on both sides. Temporary easements are required on W. 37th Street due to the need to raise of the bridge. Department of Natural Resource requirements have resulted in the height of the proposed bridge to go up in elevation approximately 3 feet. WSB and the City Attorney have been working with the nearby property owners to secure temporary easements for construction. As soon as all the easements have been secured, the project will be bid out for construction. Contract Amendment: WSB and Associates was awarded the original contract for this project in August of 2013. The original contract was limited to designing the bridge and did not include road design or account for the additional time involved in this project due to the Federal funding. Contract Amendment #1 was approved in June of 2016 and included consultant services for bid documents. The final design is now finished and the project is ready for construction. Contract Amendment #2 is for the consultant to complete construction administration and inspection for the project. Please see contract totals below. AMOUNT Original Contract – Bridge design $74,253 Amendment #1 – Road design $142,510 Amendment #2 – Construction services $346,216 Total Contract $562,979 Financial Consideration: This project was included in the City’s Capital Improvement Plan (CIP) for 2017. Below is a summary of the costs and funding sources. Estimated Costs Construction $2,516,720 Contingencies (10%) $251,672 Engineering and Administration (25%) $629,180 Temporary easements $92,250 Total $3,489,822 Funding Sources Federal Aid $2,140,914 Pavement Management Fund $1,201,003 General Obligation Bonds (sidewalk) $55,655 Sanitary Utility Fund $92,250 Total $3,489,822 City Council Meeting of April 17, 2017 (Item No. 4b) Page 3 Title: Approve Amendment to Consultant Contract – W. 37th Street Bridge & Road Reconstruction The estimated construction cost for this project is $2,516,720. The contract for engineering services with this amendment will be 25% of the estimated construction cost. Industry standard for engineering costs on construction projects can range from 20% to 35% depending on the complexity of the project. Staff has a high expectation for business support and responsiveness from the consultant. The consultant will be meeting with individual business owners to address final design questions and providing day to day construction observation services during construction. W. 37th Street is a commercial street and there are many facets of the project which will require coordination with area businesses, Xcel Energy, and Centerpoint Energy. As a result, we believe that the contract cost is consistent with the scope and demands of this project. Proposed Schedule: The following is the schedule: Open bids May 2017 Award bid June 5, 2017 Start construction June 12, 2017 Construction complete November 2017 ¥f¤ ")20¬«7AQUILAAVESZINRANAVES YUKONAVES35TH ST W 36TH ST W WYOMINGAVESBOONEAVES34 1/2 ST W XYLONAVESYUKONAVESVIRGINIAAVESDIVISION STPHILLIPS PKWY37TH ST W A Q U I L A A V E S T O W B H W Y7 S E R V I C E D R H I G H W A Y 7KNOLLWOODMALLACCESRDBOONEAVESUTAHAVES P R IV A T E RDPRIVATERDPRIVATERD 0 250 500 750 1,000Feet ¯ Legend 37th Street Construction Area ¥f¤37th Street Bridge Construction Area City Limits 37th St. W. Bridge and Street Construction Area Knollwood Mall Target City Council Meeting of April 17, 2017 (Item No. 4b) Title: Approve Amendment to Consultant Contract – W. 37th Street Bridge & Road Reconstruction Page 4 Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4c EXECUTIVE SUMMARY TITLE: Bid Tabulation: Award Bid for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200 RECOMMENDED ACTION: Motion to designate Allied Blacktop Co. the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $360,172.79 for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200). POLICY CONSIDERATION: Does the City Council wish to continue to implement our Pavement Management program? SUMMARY: A total of two (2) bids were received for this project. A summary of the bid results is as follows: CONTRACTOR BID AMOUNT Allied Blacktop Company $288,163.87 Pearson Brothers Inc. $340,352.68 ASTECH Corp. $351,155.28 Engineer’s Estimate $369,623.40 A review of the bids indicates Allied Blacktop Co. submitted the lowest bid. Allied Blacktop is a reputable contractor that has worked for the City before. Staff recommends that a contract be awarded to the firm in the amount of $288,163.87. FINANCIAL OR BUDGET CONSIDERATION: This project was planned for and included in the City’s adopted Capital Improvement Program (CIP) for 2017. The engineer’s estimate was $369,623.40. The expense for sealcoating the local streets will be paid from the Pavement Management Fund and Municipal State Aid streets are paid for out of the Operations budget. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Discussion 2017 Sealcoat Maps Prepared by: Phillip Elkin, Sr. Engineering Project Manager Reviewed by: Debra Heiser, Engineering Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4c) Page 2 Title: Bid Tabulation: Award Bid for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200 DISCUSSION BACKGROUND: Sealcoating is the surface application of an asphalt material followed b y the placement of aggregate (rock) which is embedded into the asphalt material while it is liquid. The purpose of this treatment is to add surface friction to the pavement, to seal the surface from oxidation and protect the pavements from the effects of moisture. Sealcoating can extend the life of a pavement, in good condition, by 5-9 years. The City’s Pavement Management Program provides for the sealcoating of each street once every eight (8) years. This year’s sealcoat project includes Areas 2 and 3 of the Pavement Management Program and the Fern Hill Park parking lot. These streets were last sealcoated in 2009. These areas comprise the streets in the Browndale, Minikahda Vista, Minikahda Oaks, Triangle, Wolfe Park, Cedar Manor, Kilmer, and Westwood Hills neighborhoods. Maps of the streets to be sealcoated are attached. Based on the City’s pavement management software and visual inspections by Cit y st aff, some streets in these areas were determined to be in need of more comprehensive maintenance and would not benefit from sealcoating. Thus, they have been eliminated from this project with the understanding that the y will be programmed for rehabilitation in the future, as part of the City’s overall Pavement Management Program. An advertisement for bids was published in the St. Louis Park Sun-Sailor on March 9. In addition, plans and specifications were noticed on the City Website and are made available electronically via the internet by our vendor QuestCDN.com. Email notification was provided to five minority associations and final printed plans are made available for viewing at City Hall. Funding Details: Based on the low bid received, total project cost and funding details are revised as follows: Expenditures CIP Estimate Low Bid Construction Cost $540,000 $288,163.87 Engineering 16,200 $8,644.92 $556,200 $296,808.79 Revenues Pavement Management Fund $463,836 $250,702.57 PW Operations Budget $92,364 $46,106.22 Total $556,200 $296,808.79 This project was planned for and included in the City’s adopted Capital Improvement Program. Construction Timeline: The work may begin as early as June but must be completed no later than August 30. The contractor will schedule a week to complete the work within this time frame. Streets will be posted for “No Parking” beginning the day before work is to occur. Staff will send a notice out to residents once we get a schedule to inform them of the pending work and parking restrictions. $+TORAH ACADEMY FERN HILL PARK PARKING LOT 28TH ST W FRANCE AVE S40TH ST W WOODDA L E A V EYOSEMITE AVE SMINNETONKA BLVD 35TH ST W PARK GL E N R D 38TH ST WLAKE ST W RAMP29TH ST W 27TH ST W QUENTIN AVE SBELT LINE BLVDOTTAWA AVE SSERVIC E D R H W Y 7 N 41ST S T W VERNON AVE SBROOKSIDE AVE SGLENHURST AVEZARTHAN AVE S36TH ST W (S) 42ND ST W JOPPA AVE SEXCELSIOR BLVD36TH ST WSTATE HIGHWAY 7HUNTINGTON AVE SUTICA AVE S39TH ST W 36 1/2 ST WXENWOOD AVE SWEBSTER AVE SCOUNTY RO A D 2 5 INGLEWOOD AVE SLYNN AVE SSALEM AVE S43 1/2 ST WTOLEDO AVE S34TH ST W 31ST ST W KIPLING AVE SPARK CENTER BLVD44TH ST WRALEIGH AVE SSTATE HIGHWAY 100 SPRINCETON AVE SRANDAL L A V E WOLF E P K W Y PARK C O M M O N S D R WOOD LN VALLAC H E R A V E CAMERATA WAY XENWOOD AVE SSALEM AVE SWO O D D A L E A V E 34TH ST WSALEM AVE SZARTHAN AVE S27TH ST W WEBSTER AVE SGLENHURST AVEUTICA AVE SSALEM AVE SYOSEMITE AVE SLYNN AVE SFRANCE AVE STOLEDO AVE S36TH ST W 28TH ST W TOLEDO AVE S41ST ST W UTICA AVE S39TH ST W 35TH ST W Sealcoat 2017 Area 2 ± 3/9/2017 SLP Engineering Department City Council Meeting of April 17, 2017 (Item No. 4c) Title: Bid Tabulation: Award Bid for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200 Page 3 HIGHWAY 169TEXAS AVE SINTERSTATE 394 WAYZATA BLVD FLAG AVE SMINNETONKA BLVD FORD RD VIRGINIA CIR N CLUB RD SHELARD PKWY 28TH S T WMELROSE AVE S26TH ST W VIRGINIA CIR S FRANKLI N A V E W 22ND ST W UTAH D R WESTMORELAND LN UTAH AVE S25TH ST W 30 1/2 ST WAQUILA AVE S STANLEN RD BURD PLKILMER AVEXYLON AVE S29TH ST WJORDAN AVE SPARKER RD CEDAR LA K E R D SUMTER AVE S23RD ST W 22ND LN W CAVELL AVE SBOONE AVE SFORD LN ZINRAN AVE S16TH ST W 14TH ST W VIRGINIA AVE SYUKON AVE S24TH ST W 18TH ST W SER V I C E D R H W Y 3 9 4 S VIRGINIA AVE S28TH S T W TEXAS AVE SVIRGINIA AVE S18TH ST WFLAG AVE S25TH ST W SUMTER AVE SFORD RD28TH ST W FLAG AVE SFRANKLIN AVE W Sealcoat 2017 Area 3 ± 3/9/2017 SLP Engineering Department City Council Meeting of April 17, 2017 (Item No. 4c) Title: Bid Tabulation: Award Bid for Sealcoat Streets (Area 2 & 3) – Project No. 4017-1200 Page 4 Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4d EXECUTIVE SUMMARY TITLE: Bid Tabulation: Award Bid for Connect the Park Sidewalk Project (4017-2000) RECOMMENDED ACTION: Motion to designate G.L. Contracting, Inc. the lowest responsible bidder and authorize execution of a contract with the firm in the amount of $708,909.67 for the 2017 Connect the Park Bikeway, Sidewalk and Trail - Project No. 4017-2000. POLICY CONSIDERATION: The proposed improvements are consistent with the City’s Connect the Park bikeway, sidewalk, and trail implementation plan. SUMMARY: A total of two (2) bids were received for this project. A summary of the bid results is as follows: CONTRACTOR BID AMOUNT G.L. Contracting, Inc.$ 708,909.67 Urban Companies, Inc. $ 904,083.50 Engineer’s Estimate $ 883,877.25 A review of the bids indicates G.L. Contracting submitted the lowest bid. G.L. Contracting is a reputable contractor. Staff recommends that a contract be awarded to the firm in the amount of $708,909.67. FINANCIAL OR BUDGET CONSIDERATION: This project was planned for and included in the City’s adopted Capital Improvement Program CIP for 2017. This project will be funded using General Obligation Bonds. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Discussion Prepared by: Jack Sullivan, Senior Engineering Project Manager Reviewed by: Debra Heiser, Engineering Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4d) Page 2 Title: Bid Tabulation: Award Bid for Connect the Park Sidewalk Project (4017-2000) DISCUSSION BACKGROUND: Bids were received on April 10, 2017 for the 2017 Connect the Park project- Sidewalk construction. The 2017 construction season will be the fourth year of implementing the City’s Connect the Park initiative. This construction contract included the following sidewalk segments: •Xenwood Avenue – sidewalk ( West side between 27th Street and 29th Street) •36 1/2th Street – sidewalk (North side between Monterey Drive and Excelsior Boulevard) •Barry Street – sidewalk (South/West side between 26th Street and Highway 100) In addition to the sidewalk construction, three Rapid Rectangular Flashing Beacon (RRFB) poles will be installed with this contract. Locations with higher pedestrian crossing traffic were slated to be enhanced with the installation of push-activated RRFBs. •Crossing of Monterey Drive at 36 1/2th Street •Crossing of France Avenue at Cedarwood Road •Barry Street at the Benilde St. Margaret West Entrance Additional construction contracts will be let later this spring that includes the following trail and bikeway segments: •Utica Avenue – trail (West side between 27th Street and North Cedar Lake Regional Trail) •28th Street corridor – bikeway (Between Virginia Avenue and Highway 100) •Texas Avenue – bikeway (Between Minnetonka Boulevard and 28th Street) •Texas Avenue corridor – bikeway (Between Highway 7 and Cedar Lake Regional Trail) An advertisement for bids was published in the St. Louis Park Sun-Sailor on March 16, 2017. In addition, plans and specifications are noticed on the City Website and are made available electronically via the internet by our vendor QuestCDN.com. Email notification was provided to five minority associations and final printed plans were available for viewing at Dodge Data, Construct Connect, Minnesota Builders Exchange, and at City Hall. Twenty six (26) contractors/vendors purchased plan sets with four (4) Disadvantaged Business Enterprises (DBE) identifying themselves as subcontractors. Funding Details Staff has analyzed the bids and determined that G&L Excavating, Inc. is a qualified contractor that can complete this work during the 2017 construction season. The low bid does not exceed the funding levels approved for these projects in the City’s 2017 CIP. Based on the low bid received, cost details are as follows: CIP Estimate Low Bid Construction Cost $883,877.25 $708,909.67 Contingencies (10%) NA $70,890.96 Engineering & Administration $220,969.31 $194,950.16 Total $1,104,846.56 $974,750.80 Construction Timeline: Construction is anticipated to begin in May and should be completed by late August 2017. Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4e EXECUTIVE SUMMARY TITLE: Approve Agency Agreement No 1027745 with MnDOT for W. 37th Street Bridge & Road Reconstruction (4017-1700) RECOMMENDED ACTION: Motion to Adopt Resolution authorizing entering into Agency Agreement No. 1027745 with MnDOT for the W. 37th Street Bridge and Road Reconstruction Project (Boone Ave. to Aquila Ave.) Project No. 4017-1700. POLICY CONSIDERATION: Does the City Council wish to continue to take the necessary steps to keep this project on schedule for construction in 2017? SUMMARY: This summer, W. 37th Street will be reconstructed between Boone Avenue and Aquila Avenue, this includes the reconstruction of the bridge over Minnehaha Creek. Because of the project’s use of federal funding for the bridge, several procedural approvals and sign-offs of the construction plans by the State of Minnesota (MnDOT) and Federal Highway Administration (FHWA) are required prior to advertising for bids. The attached Agency Agreement between the City of St. Louis Park and MnDOT must be approved by the City Council prior to the opening of bids. The Agency Agreement is similar and consistent with agreements for other projects that the City has entered into with MnDOT in the past. Essentially, the agreement defines the responsibilities of MnDOT and the City in regards to funding. Federal funds of up to $2,519,720.86 are available for this project. At this time, the estimate for the bridge includes a need for federal funding of $2,140,914. These funds are pay as you go and will be passed to the City through MnDOT. This project is currently scheduled to be bid in May with a construction start of June. The project will be complete in November of 2017. FINANCIAL OR BUDGET CONSIDERATION: This project is included in the City’s Capital Improvement Program (CIP) for 2017. Funding will be provided by a combination of Federal Aid, Pavement Management funds, Utility funds, and General Obligation Bonds (Connect the Park). VISION CONSIDERATION: Not Applicable SUPPORTING DOCUMENTS: Resolution MnDOT Agreement #1027745 Prepared by: Joseph Shamla, Sr. Engineering Project Manager Reviewed by: Debra M. Heiser, Engineering Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4e) Page 2 Title: Approve Agency Agreement No 1027745 w/ MnDOT - W. 37th Street Bridge & Road Reconstruction RESOLUTION NO. 17-___ RESOLUTION AUTHORIZING ENTERING INTO MNDOT AGENCY AGREEMENT NO. 102775 FOR FEDERAL PARTICIPATION IN ADVANCE CONSTRUCION OF W. 37TH STREET BRIDGE WHEREAS, plans and specifications have been completed for the W. 37th Street Bridge and Road Reconstruction Project (Boone Ave. to Aquila Ave.) Project No. 4017-1700; and WHEREAS, plans and specifications for the construction of said improvements have been approved by the City Council; and WHEREAS, the Project will be paid for, in part, using Federal Funds. NOW THEREFORE BE IT RESOLVED, by the City Council of the City of St. Louis Park, Minnesota, that pursuant to Minnesota Stat. Sec. 161.36, the Commissioner of Transportation be appointed as Agent of the City of St. Louis Park to accept as its agent, federal aid funds which may be made available for eligible transportation related projects. BE IT FURTHER RESOLVED, the Mayor and the City Manager are hereby authorized and directed for and on behalf of the City to execute and enter into an agreement with the Commissioner of Transportation prescribing the terms and conditions of said federal aid participation as set forth and contained in “Minnesota Department of Transportation Agency Agreement No. 1027745”, a copy of which said agreement was before the City Council and which is made a part hereof by reference. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk MnDOT Agreement No. 1027745 STATE OF MINNESOTA AGENCY AGREEMENT BETWEEN DEPARTMENT OF TRANSPORTATION AND CITY OF ST. LOUIS PARK FOR FEDERAL PARTICIPATION IN ADVANCE CONSTRUCTION FOR S.P. 163-080-002; M.P. BROS 2717(089) This agreement is entered into by and between City of St. Louis Park ("City") and the State of Minnesota acting through its Commissioner of Transportation ("Mn DOT"), Agency Agreement No. 99921 which has been executed between the City and MnDOT, appoints MnDOT as the City's agent to receive and disburse transportation related federal funds, and sets forth duties and responsibilities for letting, payment, and other procedures for a federally funded contract let by the City; and Pursuant to Minnesota Statutes Section 161.36, the City desires MnDOT to act as the City's agent to accept and disburse federal funds for the construction, improvement, or enhancement of transportation financed in whole or in part by federal funds; and The City is proposing a federal aid project to replace bridge number 27067 over Minnehaha Creek, hereinafter referred to as the "Project"; and The Project has been determined to be eligible for the expenditure of federal aid funds and is programmed in the approved federally approved STIP for the fiscal years 2017 and 2018; and the project is identified in MnDOT records as State Project 163-080-002, and in Federal Highway Administration ("FHWA") records as Minnesota Project BROS 2717(089); and The City desires to proceed with the construction of the project in advance of the year it is programmed for the federal funds; and It is permissible under Federal Highway Administration procedures to perform advance construction of eligible projects with non-federal funds, with the intent to request federal funding for the federally eligible costs in a subsequent federal fiscal year(s), if sufficient funding and obligation authority are available; and The City desires to temporarily provide City State Aid and/or other local funds in lieu of the federal funds so that the project may proceed prior to the fiscal year(s) designated in the STIP; and MnDOT requires that the terms and conditions of this agency be set forth in an agreement. (MnDOT Agreement No. 1027745) Page 1 City Council Meeting of April 17, 2017 (Item No. 4e) Title: Approve Agency Agreement No 1027745 w/ MnDOT - W. 37th Street Bridge & Road Reconstruction Page 3 THE PARTIES AGREE AS FOLLOWS: I.DUTIES OF THE CITY. A.The City will let a contract and construct the Project in accordance with Agency Agreement No. 99921. Payment provisions for federally eligible costs will be as stated herein. B.It is estimated that the total cost of the Project is$ 2,519,720.86. The remaining share will be paid by the City. 1.Of these Bridge Off-System funds, $1,200,000 is available in federal fiscal year 2017. 2.Of these Bridge Off-System funds, $238,400 is available in federal fiscal year 2018. C.The City will pay any part of the cost or expense of the Project that is not paid by federal funds. D.Request f or reimbursement of the federal aid share of the federally eligible costs can be made any time after the work is completed, however payment may not be made until after October 1, 2017 for federal fiscal year 2018. It could be earlier if funding and obligation authority are available (subject to the Area Transportation Partnership (ATP) policy). E.If the project is converted to federal funding before completion and final acceptance, requests for reimbursement will occur as partial estimates in accordance with Agency Agreement No. 99921. F.Under Minnesota Statutes § 16C.05, subd. 5, the City's books, records, documents, and accounting procedures and practices relevant to this Agreement are subject to examination by the State and the State Auditor or Legislative Auditor, as appropriate, for a minimum of six years. II.DUTIES OF MnDOT. A.Mn DOT will make the necessary requests to the FHWA for authorization to use federal funds for the Project and designation as an Advance Construction project. B.Mn DOT will request the conversion of the Project to federal funding of eligible costs, when funding and obligation authority are available. C.At such time that the project is converted to federal funding and such funding is received by Mn DOT, Mn DOT will reimburse to the City the federal aid share of the federally eligible costs, previously provided by the City. Reimbursement for City State Aid funds used in lieu of federal funds, will be deposited in the City's State Aid Account. Reimbursement for other City funds used in lieu of federal funds will be forwarded to the City. (MnDOT Agreement No. 1027745) Page 2 City Council Meeting of April 17, 2017 (Item No. 4e) Title: Approve Agency Agreement No 1027745 w/ MnDOT - W. 37th Street Bridge & Road Reconstruction Page 4 Ill. AUTHORIZED REPRESENTATIVES. Each authorized representative will have responsibility to administer this agreement and to ensure that all payments due to the other party are paid pursuant to the terms of this agreement. A.The City authorized representative is Deb Heiser, St. Louis Park City Engineer, 5005 Minnetonka Boulevard, St. Louis Park, MN 55416-2290, phone 952 924- 2662, or her successor. B.MnDOT's authorized representative is Lynnette Roshell, Minnesota Department of Transportation, State Aid f or Local Transportation, 395 John Ireland Boulevard, Mail Stop 500, St Paul, MN 55155, phone 651-366-3822, or her successor. IV.TORT LIABILITY. Each party is responsible for its own acts and omissions and the results thereof to the extent authorized by law and will not be responsible for the acts and omissions of any others and the results thereof. The Minnesota Tort Claims Act, Minnesota Statutes Section 3. 736, governs Mn DOT liability. V.ASSIGNMENT. Neither party will assign or transfer any rights or obligations under this agreement without prior written approval of the other party. VI.AMENDMENTS. Any amendments/supplements to this Agreement must be in writing and be executed by the same parties who executed the original agreement, or their successors in office. VII.TERM OF AGREEMENT. This agreement will be effective upon execution by the City and by appropriate State officials, pursuant to Minnesota Statutes Section 16C.05, and will remain in effect for five (5) years from the effective date or until all obligations set forth in this agreement have been satisfactorily fulfilled, whichever occurs first. VIII.TERMINATION. This agreement may be terminated by the City or MnDOT at any time, with or without cause, upon ninety (90) days written notice to the other party. Such termination will not remove any unfulfilled financial obligations of the City as set f orth in this Agreement. In the event of such a termination the City will be entitled to reimbursement for MnDOT-approved federally eligible expenses incurred for work satisfactorily performed on the Project to the date of termination subject to the terms of this agreement. Remainder of this page left intentionally blank (Mn DOT Agreement No. I 027745) Page3 City Council Meeting of April 17, 2017 (Item No. 4e) Title: Approve Agency Agreement No 1027745 w/ MnDOT - W. 37th Street Bridge & Road Reconstruction Page 5 IN WITNESS WHEREOF, the parties have caused this Agreement to be duly executed intending to be bound thereby. CITY City certifies that the appropriate person(s) have executed the contract on its behalf as required by applicable resolutions, ordinances, or charter provisions By:-------------- Date: _____________ _ Title: _____________ _ By:-------------- Date: _____________ _ Title: ______________ � Page 4 DEPARTMENT OF TRANSPORTATION By: _____________ _ Title: Director State Aid for Local Transportation Date: _____________ _ COMMISSIONER OF ADMINISTRATION By: _____________ _ Date: ______________ _ (MnDOT Agreement No. 1027745) City Council Meeting of April 17, 2017 (Item No. 4e) Title: Approve Agency Agreement No 1027745 w/ MnDOT - W. 37th Street Bridge & Road Reconstruction Page 6 Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4f EXECUTIVE SUMMARY TITLE: 2017/2018 Neighborhood Grants RECOMMENDED ACTION: Motion to approve the 2017/2018 Neighborhood Grants. POLICY CONSIDERATION: Does Council wish to approve the allocation of neighborhood grants for 2017/2018? SUMMARY: Each year grant funding is made available to neighborhood associations to promote strong neighborhoods and enhance community connections by bringing neighbors together. Grant applications from 22 neighborhoods were received in March. On Tuesday, March 28 Breanna Freedman facilitated the grant review process with Grant Review Committee Members Erica Bagstad (Westwood Hills), Darla Monson (City Staff), Alex Draeger (City Staff) and Katherine Arnold (Browndale). The Grant Review Committee met to review the grant applications and make funding recommendations to the City Council. Attached is a worksheet that provides specific detail on the recommendations made by the Grant Review Committee. FINANCIAL OR BUDGET CONSIDERATION: The Grant Review Committee recommends approval of $36,636 to fund the following 22 neighborhood grants: $1000 Aquila $2100 Birchwood $1943 Blackstone $1960 Bronx Park $393 Brooklawns $2100 Brookside $2100 Browndale $1200 Cobblecrest $1740 Creekside $1225 Crestview $1550 Eliot View $2100 Elmwood $910 Kilmer Pond $1405 Lake Forest $2100 Meadowbrook $2000 Minikahda Oaks $1665 Minikahda Vista $2100 Minnehaha $2100 Sorensen $1400 South Oak Hill $1500 Westwood Hills $2045 Wolfe Park The Grant Review Committee recommends approval of $1,970 to fund the environmental grants for sixteen neighborhoods. The Grant Review Committee recommends approval of $5,525 to fund insurance purchases for fourteen neighborhoods. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Discussion 2017/18 Neighborhood Grant Guidelines 2017/18 Neighborhood Grant Worksheet Prepared by: Breanna Freedman, Community Liaison Reviewed by: Michael Harcey, Chief of Police Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4f) Page 2 Title: 2017/2018 Neighborhood Grants DISCUSSION BACKGROUND: Each year grant funding is made available to neighborhood associations to promote strong neighborhoods and enhance community connections by bringing neighbors together. The City Council appropriated $42,000 in grant funds for the 2017 neighborhood grant program, $2,000 for environmental initiatives, and $8,000 for insurance. Neighborhood Associations are responsible for providing insurance when planning neighborhood events in parks that bring outside equipment into the park such as, but not limited to, moonwalks, petting zoos, etc. Neighborhood associations can apply for a maximum of $500 in addition to the standard grant to assist with purchasing insurance. Grant applications from 22 neighborhoods were received in March. The total grant request for 2017/2018 was $37,511. Fourteen of these neighborhoods also applied for additional insurance reimbursements and sixteen neighborhoods applied for the environmental component. The total amount applied for the environmental component came in slightly over budget at $2,045; therefore, one neighborhood’s environmental component request of $75 was reallocated to the general grant fund in order to meet the $2,000 total environmental fund limit. In the past year, a few neighborhoods have become more active and are planning more events and activities for their neighborhood. There are some neighborhoods that have been stagnant or declined in activity and did not apply for much additional funding than in previous years. Outside of those exceptions, most neighborhoods have been active and utilize all or a majority of the grant money provided. There was one neighborhood, Meadowbrook, which became organized last year that applied for the 2017/18 grant, and two neighborhoods, Lenox and Cedar Manor, which did not reapply for the 2017/18 grant program. The Grant Review Committee that met on Tuesday, March 28 evaluated each grant application and made funding recommendations to meet the $42,000 budget for the neighborhood grants. The grant applications came in $4,489 under budget, making this year’s grant review process different from years in the past. Although there was additional funding available, the Grant Review Committee did not fund projects or activities that did not fall within the grant guidelines. Changes are anticipated to be made in future years to allow neighborhoods to apply for more funding in order to keep the process competitive and to streamline additional funding to the neighborhood associations. The committee made up of two residents and two city staff members did an excellent job evaluating each grant against the grant guidelines. In doing so, they met the goal of the grants which is to support neighborhoods and enhance community connections by bringing neighbors together. City Council Meeting of April 17, 2017 (Item No. 4f) Page 3 Title: 2017/2018 Neighborhood Grants NEIGHBORHOOD REVITALIZATION PROGRAM 2017/2018 GRANT GUIDELINES Grant Purpose - In 1996, the City of St. Louis Park established this grant program to support neighborhoods and enhance community connections by bringing neighbors together. Financial support is provided for special projects initiated by neighbors to address issues, implement ideas or create opportunities that are meaningful and important to their neighborhoods. This purpose still applies today and supports the Vision Strategic Direction: St. Louis Park is committed to being a connected and engaged community. In 2017/2018, up to $42,000 in grants will be available to organized St. Louis Park neighborhoods for activities that physically improve the neighborhood, enhance the sense of community within the neighborhood, support citizen involvement, or develop neighborhood leadership. Environmental Grant - An additional $2,000 in grants will be available to neighborhoods that incorporate an environmental component either in conjunction with an existing event or adding a new program/event. This new grant element ties to the Vision Strategic Direction: St. Louis Park is committed to being a leader in environmental stewardship. We will increase environmental consciousness and responsibility in all areas of city business. Money is also available for neighborhood associations seeking additional insurance for neighborhood activities. More information is available on page 3 under “Funding for Insurance”. Eligible Activities - Examples of eligible uses for grant funds are: newsletters, meetings, postage, picnics, parties, youth or senior programs, new neighbor welcome, hayrides, ice cream socials, children’s parades, entrance signs, flower plantings, park improvements or community gardens. However, neighborhoods are not limited to these examples. Residents are encouraged to be creative in assessing their needs and determining the projects they want to undertake as a neighborhood. Neighborhood leaders are required to include neighborhood resident input for proposed projects. How you choose to receive this input must be included in the grant application. A few examples of eligible expenses for the environmental component are: purchasing environmentally friendly products for a neighborhood event, hosting an earth day or buckthorn removal event, and working with our Parks & Rec department to add plants or recycling containers to a park. Eligible Applicants - In order to be eligible for the Neighborhood Grants, you MUST be recognized as a neighborhood association. To be recognized as a neighborhood association, you must demonstrate and document that your neighborhood association meets the following requirements: 1.Must have at least three elected officers from the neighborhood 2. Have a method of transferring leadership from one year to the next 3. Written bylaws approved by its membership, which must be reviewed annually 4. Must hold an annual neighborhood meeting City Council Meeting of April 17, 2017 (Item No. 4f) Page 4 Title: 2017/2018 Neighborhood Grants Matching Grant Funds - To qualify for a grant, a neighborhood must demonstrate how it will contribute to or leverage the Neighborhood Revitalization grant funds. A match of neighborhood resources maximizes the use of limited City funds and confirms the commitment from each neighborhood. Neighborhoods should provide a 100% (dollar for dollar) match to the grant amount. Any combination of sources is acceptable in calculating the neighborhood match. These can be in the form of: •cash raised through fundraising •fees collected at activities •donations from businesses, civic groups, etc. • in-kind services or sweat equity Innovative Projects - The neighborhood activity cannot duplicate a service already in place. Improvements to Private Property - Neighborhoods should be aware that legal issues limit the use of City funds to improve private property. Applicants should be able to clearly demonstrate a strong public purpose for funds proposed to improve private property in any way. Improvements to Public Land or Parks - Physical improvements to any public property must be coordinated with the appropriate City department. It should not conflict with or duplicate a project in the City’s Capital Improvements Program. A letter of feasibility must be included with a grant application that requests funding for park improvements. This letter should confirm that the appropriate City department has reviewed the proposed improvements, that the proposal is feasible, and that the project budget is a reasonable estimate of project costs. City department contacts for capital improvements: •Rick Beane, Parks and Recreation Department, 952-928-2854 Old Grants - Neighborhoods with a previous grant must close out their account before new grant funds are awarded. The deadline to close out 2015 grants is April 30, 2016. Neighborhoods that received a lump sum advance amount for a 2015 grant must turn in all outstanding receipts or reimburse the city for funds not used. 2017/2018 Grant Deadlines - 2017/18 grants will run from May 1, 2017 to April 30, 2018. All receipts for expenses incurred in 2017 should be turned in by January 31, 2018. All 2018 receipts are due by May 1, 2018. Funding Priorities - Up to $42,000 is available for grants to neighborhoods in this funding cycle, with an additional $2,000 available for environmental components. However, with 25 organized neighborhoods eligible for funds, the process is competitive. Neighborhood leaders are advised to request funds for their most important needs. During the grant review process, greater consideration will be given to proposals that enhance community connections and show a greater match amount. Lesser consideration will be given to proposals for park improvements and proposals that show a large expenditure for a single activity. Garage sales will be given the lowest priority. If grant requests exceed the amount available for funding, garage sales will not be funded. Funding for Insurance - When planning neighborhood events in parks, you may be required to make provisions to use your own insurance. Neighborhood Associations are responsible for providing outside insurance when planning neighborhood events in parks that bring outside City Council Meeting of April 17, 2017 (Item No. 4f) Page 5 Title: 2017/2018 Neighborhood Grants equipment into the park such as, but not limited to moonwalks, petting zoos, etc. Without clear delineation of who is responsible in case of accidents, neighborhood leaders may be held liable. To assist neighborhood associations with purchasing additional insurance, you can apply for a maximum of $500 per neighborhood in addition to the standard grant request. This money is strictly for insurance and cannot be used for any other reimbursement. Award Limits Group activities, social events and meetings are considered for funding up to a maximum of $800 per activity. There is a $2100 grant award limit per neighborhood for all requests. Any neighborhood requesting more than $1500 is advised to include priority preferences on their application. Neighborhoods can apply for up to $150 for environmental projects. $500 per neighborhood is available for the purchase of insurance. Grant Process Steps 1.Apply - Applications must be received by 4:30 p.m. on Friday, March 17, 2017. They may be mailed or hand-delivered to Breanna Freedman, Community Liaison, City of St. Louis Park, 3015 Raleigh Ave. South, St. Louis Park, MN 55416. Grants may also be submitted by email to bfreedman@stlouispark.org or faxed to 952-924-2676. Any applications received after the deadline will not be eligible to receive a grant. Please email Breanna if you would like to receive an electronic grant application. 2.Review Time - City staff and a committee of volunteer neighborhood leaders will review the grant proposals and make recommendations for approval to the City Manager. 3.Final Approval - Final authorization of the awards will be approved at a City Council Meeting late April or early May. 4.Signed Agreements - Within two weeks of approval, each recipient neighborhood will receive a grant agreement from the City. The agreement must be signed and returned prior to any funds being released. Pre-application Assistance - All applicants are strongly encouraged to talk to city staff as they work to identify projects and put together their applications. This will help to ensure complete and accurate applications, as well as streamline application review. Electronic Application - Contact Breanna Freedman at bfreedman@stlouispark.org or 952- 924-2184 if you would like an electronic application (Microsoft Excel) emailed to you. Questions? Contact Breanna Freedman, Community Liaison (952) 924-2184 or bfreedman@stlouispark.org City Council Meeting of April 17, 2017 (Item No. 4f) Page 6 Title: 2017/2018 Neighborhood Grants 2017 Grant Committee Worksheet Grant Review Committee Meeting, Tuesday, March 28 at 5:30 p.m. in the Aquila Room of City Hall The Grant Review Committee reviewed the 22 neighborhood grant applications from the eligible neighborhood associations. Requests totaled $37,511 Total Amount Recommended: $36,636 Insurance Requests came in under budget Environmental Requests came in over budget Requested Amount Recommended Amount $1,000 Aquila $1,000 $500 Picnic/Annual Meeting $400 Communications $100 Plant Exchange & Story night $75 Insurance Request $75 $125 Trail Clean Up $125 $2,100 Birchwood $2,100 $450 Ice Cream Social/Summer Party $200 Newsletter $550 Winter Party $500 Movie Night $400 Fun Run/Walk $500 Insurance Request $500 $150 Pollinator Plantings $150 $1,943 Blackstone $1,943 $318 Porta Potty $100 Blackstone Park Lawn & Trees $325 Ice Cream & Sliders $550 National Night Out $400 Pizza Night $100 Election/Winter Gathering $150 Operating Support $150 Insurance Request $150 $150 Flowers for Blackstone Park $150 City Council Meeting of April 17, 2017 (Item No. 4f) Page 7 Title: 2017/2018 Neighborhood Grants Requested Amount Recommended Amount $1,960 Bronx Park $1,960 $700 Annual Neighborhood Picnic $700 Social Activities $400 Neighborhood Newsletter $160 General Meeting Expenses $500 Insurance Request $500 $318 Brooklawns $393 $135 Summer Block Party Moved the environmental component to the general fund request. $100 Summer Bowling $50 Fall Planter Sale $8 Summer Planter Sale $25 Egg Hunt $75 Justad Relief $0 $2,100 Brookside $2,100 $600 National Night Out $250 Annual Meeting $250 Movie Nights at Jackley Park $150 Patriotic Bike Parade $100 Skating Parties at Jackley Park $100 Welcome Baskets $100 Halloween Party $200 Neighborhood Socials $200 Ice Cream Social $150 Porta Potty at Jackley (shared with Creekside) $400 Insurance Request $400 $100 Weed and Clean up Noise Wall $100 $2,100 Browndale $2,100 $200 Browndale Goes $600 Fall Bonfire & Bluegrass $750 Family Camp Outs $200 Winterfest $200 Spring Egg Hunt $150 July 4th Kiddie Parade $500 Insurance Request $500 $150 Earth Day Clean Up $150 City Council Meeting of April 17, 2017 (Item No. 4f) Page 8 Title: 2017/2018 Neighborhood Grants Requested Amount Recommended Amount $1,200 Cobblecrest $1,200 $800 Hayride/Family Day at Aquila $500 National Night Out & Neighborhood Gatherings $500 Insurance Request $500 $50 Compostable Products $50 $1,740 $1,740 Creekside $45 Plant Exchange $525 Block party $175 Porta Potty at Jackley (shared with Brookside) $130 Butterfly Garden $175 Winter Solstace $50 Flower planter at Excelsior $50 Reusable Signs $50 Neighborhood Bike Ride $500 Bowling Event $40 National Night Out $150 Creekside Cleanup $150 $500 Insurance Request $500 $1,225 Crestview $1,225 $700 Movie Night $525 Summer Solstice Picnic $1,550 Eliot View $1,550 $600 Annual Picnic & Election $500 Youth Activity/Fitness $150 Shade tent $300 Movie Night City Council Meeting of April 17, 2017 (Item No. 4f) Page 9 Title: 2017/2018 Neighborhood Grants Requested Amount Recommended Amount $2,100 Elmwood $2,100 $650 Summer Picnic $400 Kids Halloween and Pumpkin Carving Party $400 Bowling Party $50 Annual Meeting $600 Porta Potty at Central $150 Porta Potty Rental $150 $500 Insurance $500 $910 Kilmer Pond $910 $700 Halloween Hayride $147 National Night Out $63 Ice Cream Social $1,405 Lake Forest $1,405 $690 Neighborhood Annual Summer Party $245 National Night Out Block parties $50 General Association Supplies $180 Neighborhood Fend and sign maintenance $240 Neighborhood Gardens $150 Compostable Products $150.00 $2,100 Meadowbrook 2100 $700.00 Meadowbrook Manor Access Walkway-Barn Raising $700.00 Meadowbrook Neighborhood Night Out Picnic $700.00 Samosas and Sandwiches $2,000 Minikahda Oaks $2,000 $400 Spring Eye Opener and Planting $200 National Night Out $600 Annual Picnic $500 Progressive Dinner $300 Spring Egg Hunt $500 Insurance Request $500 $150 Neighborhood Clean up and Beautification $150 City Council Meeting of April 17, 2017 (Item No. 4f) Page 10 Title: 2017/2018 Neighborhood Grants Requested Amount Recommended Amount $1,665.00 Minikahda Vista $1,665 $200 Annual Meeting $300 Movie in the Park $265 Scavenger Hunt $900 National Night Out $300 Insurance Request $300 $75 Plant Swap $75 $2,750 Minnehaha $2,100 $700 National Night Out Cut $350 from National Night Out (games), $200 from Children's playtime, and $100 from the Halloween party/Sledding party/BBQ $700 Children's Play Time $575 Movie Nights $300 Happy Hours $475 Halloween Party/Sledding Party/Neighborhood BBQ $150 $150 $2,125 Sorensen $2,100 $725 Neighborhood Newsletters Cut $25 from Annual Fall Social to meet maximum amount awarded. $455 Annual Fall Social $250 Annual Sorensen Meeting $240 Webster Park Porta Potty $255 Neighborhood Event Sign Replacement $200 Wine and Cheese Fundraiser $150 LED light bulbs $150 $1,400 South Oak Hill $1,400 $700 Neighborhood BBQ and Potluck $200 Neighborhood Meeting and Pizza $250 Summer Ice Cream Social $250 Neighborhood Happy Hours $500 Insurance Request $500 City Council Meeting of April 17, 2017 (Item No. 4f) Page 11 Title: 2017/2018 Neighborhood Grants Requested Amount Recommended Amount $1,700 Westwood Hills $1,500 $100 Ladies Night Out Cut $200 from Bocce Ball Night. Lacking clarification in grant application. $450 Bowling Party $200 Bocce Ball Night $150 Guys Night Out $200 Summer Kick Off Party $600 National Night Out $100 Insurance Request $100 $150 Neighborhood Native Plants $150 $2,120 Wolfe Park $2,045 $400 National Night Out at Steel Toe Brewery Cut $75 from Halloween Party for pavilion rental (free city- building rental to neighborhood associations). $275 Halloween Party $700 Newsletter $145 Picnic and Concert in Wolfe Park $600 Annual Neighborhood Meeting and Cultural Event $500 Insurance Request $500 $120 Wolfe Park and Bass Lake Clean Up $120 Total Recommended Amount $37,511 Total Requested by All Neighborhoods $36,636 $5,525 Total Insurance Request $5,525 $2,045 Total Environmental Request $1,970 Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4g EXECUTIVE SUMMARY TITLE: Accept $1,000 Donation from Minneapolis Auto Club Foundation for Safety Camp RECOMMENDED ACTION: Motion to Adopt Resolution approving acceptance of a grant from the Minneapolis Auto Club Foundation for Safety in the amount of $1,000 for the purchase of Safety Camp t-shirts as a part of the annual Safety Camp event. POLICY CONSIDERATION: Does the City Council wish to accept the gift with restrictions on its use? SUMMARY: State statute requires City Council’s acceptance of donations. This requirement is necessary in order to make sure the City Council has knowledge of any restrictions placed on the use of each donation prior to it being expended. The Minneapolis Auto Club Foundation for Safety has graciously awarded to the Operations and Recreation Department a grant in the amount of $1,000. The grant is given for the St. Louis Park Safety Camp program to purchase t-shirts for the annual Safety Camp event which will be held on July 14 this year. FINANCIAL OR BUDGET CONSIDERATION: This donation will be used to purchase t- shirts for Safety Camp participants. VISION CONSIDERATION: St. Louis Park is committed to being a connected and engaged community. SUPPORTING DOCUMENTS: Resolution Prepared by: Stacy M. Voelker, Senior Office Assistant Lisa Abernathy, Recreation Supervisor Reviewed by: Cynthia S. Walsh, Director of Operations & Recreation Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4g) Page 2 Title: Accept $1,000 Donation from Minneapolis Auto Club Foundation for Safety Camp RESOLUTION NO. 17-____ RESOLUTION APPROVING ACCEPTANCE OF A DONATION FROM THE MINNEAPOLIS AUTO CLUB FOUNDATION IN THE AMOUNT OF $1,000 TO PURCHASE T-SHIRTS FOR SAFETY CAMP PARTICIPANTS WHEREAS, The City of St. Louis Park is required by State statute to authorize acceptance of any donations; and WHEREAS, the City Council must also ratify any restrictions placed on the donation by the donor; and WHEREAS, the Minneapolis Auto Club Foundation for Safety awarded the city a grant in the amount of $1,000 to purchase t-shirts for safety camp participants; and NOW THEREFORE BE IT RESOLVED, by the City Council of the City of St. Louis Park that the donation is hereby accepted with thanks to Minneapolis Auto Club Foundation for Safety with the understanding that it must be used to purchase t-shirts for safety camp participants. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4h EXECUTIVE SUMMARY TITLE: Accept Monetary Donation from Becky Finnigan to Westwood Hills Nature Center ($1,000) RECOMMENDED ACTION: Motion to Adopt Resolution approving acceptance of a monetary donation from Becky Finnigan in the amount of $1,000 for park maintenance and enhancements at Westwood Hills Nature Center. POLICY CONSIDERATION: Does the City Council wish to accept the gift with restrictions on its use? SUMMARY: State statute requires City Council’s acceptance of donations. This requirement is necessary in order to make sure the City Council has knowledge of any restrictions placed on the use of each donation prior to it being expended. Becky Finnigan graciously donated $1,000 to Westwood Hills Nature Center. The donation is given with the restriction that it be used for park maintenance and enhancements at Westwood Hills Nature Center. FINANCIAL OR BUDGET CONSIDERATION: This donation will be used for park maintenance and enhancements at Westwood Hills Nature Center. VISION CONSIDERATION: St. Louis Park is committed to being a leader in environmental stewardship. We will increase environmental consciousness and responsibility in all areas of city business. SUPPORTING DOCUMENTS: Resolution Prepared by: Carrie Mandler, Secretary / Program Aide Reviewed by: Mark Oestreich, Manager of Westwood Hills Nature Center Cynthia S. Walsh, Director of Operations & Recreation Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4h) Page 2 Title: Accept Monetary Donation from Becky Finnigan to Westwood Hills Nature Center ($1,000) RESOLUTION NO. 17-____ RESOLUTION APPROVING ACCEPTANCE OF DONATION IN THE AMOUNT OF $1,000 FOR PARK MAINTENANCE AND ENHANCEMENTS AT WESTWOOD HILLS NATURE CENTER WHEREAS, The City of St. Louis Park is required by State statute to authorize acceptance of any donations; and WHEREAS, the City Council must also ratify any restrictions placed on the donation by the donor; and WHEREAS, Becky Finnigan donated $1,000 to Westwood Hills Nature Center; and NOW THEREFORE BE IT RESOLVED, by the City Council of the City of St. Louis Park that the gift is hereby accepted with thanks to Becky Finnigan with the understanding that it must be used for park maintenance and enhancements at Westwood Hills Nature Center. Reviewed for Administration Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4i EXECUTIVE SUMMARY TITLE: Accept Monetary Scholarship from Minnesota Government Finance Officers Association RECOMMENDED ACTION: Motion to Adopt Resolution approving acceptance of a scholarship from Minnesota Government Finance Officers Association (MNGFOA) for registration, hotel, and transportation expenses for Tim Simon, Chief Financial Officer to attend the 2017 Advanced Government Finance Institute held July 30th – August 4th, 2017 in Madison, Wisconsin in an approximate amount not to exceed $2,300. POLICY CONSIDERATION: Does the City Council wish to accept the scholarship with restrictions on its use? SUMMARY: State statute requires City Council acceptance of donations/scholarship. This requirement is necessary in order to make sure the City Council has knowledge of any restrictions placed on the use of each donation/scholarship prior to it being expended. The Minnesota Government Finance Officers Association (MNGFOA), which is made up of over 500 members, has graciously given the Lori Ann Webster Advanced Government Finance Institute Scholarship to Tim Simon, to attend the five-day program, with up to 50 Government Finance Officer Association members from across the United States and Canada. The program will focus on enhancing leadership skills and emerging trends within the public finance sector in partnership with the University of Wisconsin-Madison’s School of Business. FINANCIAL OR BUDGET CONSIDERATION: This scholarship must be used toward the expenses incurred by Tim Simon’s attendance to the 2017 Advanced Government Finance Institute held July 30th – August 4th, 2017 in Madison, Wisconsin. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Resolution Prepared by: Tim Simon, Chief Financial Officer Reviewed by: Nancy Deno, Deputy City Manager/HR Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4i) Page 2 Title: Accept Monetary Scholarship from Minnesota Government Finance Officers Association RESOLUTION NO. 17-____ RESOLUTION APPROVING ACCEPTANCE OF A SCHOLARSHIP IN THE AMOUNT OF $2,300 FROM MINNESOTA GOVERNEMENT FINANCE ASSOCIATION FOR EXPENSES FOR TIM SIMON, CHIEF FINANCIAL OFFICER, TO ATTEND THE 2017 ADVANCED GOVERNMENT FINANCE INSTITUTE JULY 30 –AUGUST 4, 2017 IN MADISON, WISCONSIN WHEREAS, The City of St. Louis Park is required by State statute to authorize acceptance of any donations/scholarship; and WHEREAS, the City Council must also ratify any restrictions placed on the donation/scholarship by the donor; and WHEREAS, Minnesota Government Finance Officers Association will pay for the Advance Government Finance Institute registration, hotel, and travel expenses in an approximate amount up to $2,300 for Tim Simon, Chief Financial Officer, to attend the Advanced Government Finance Institute held July 30th – August 4th, 2017 in Madison, Wisconsin; and NOW THEREFORE BE IT RESOLVED, by the City Council of the City of St. Louis Park that the scholarship is hereby accepted with thanks to Minnesota Government Finance Officers Association with the understanding that it must be used for registration, hotel, and travel expenses incurred by Tim Simon to attend the Advance Government Finance Institute held July 30th – August 4th, 2017 in Madison, Wisconsin. Reviewed for Administration Adopted by the City Council April 17, 2017 Thomas K. Harmening City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4j EXECUTIVE SUMMARY TITLE: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota RECOMMENDED ACTION: Motion to Adopt Resolution authorizing the Mayor and City Clerk to sign the joint powers agreement for the Criminal Justice Data Communications Network as maintained by the BCA. POLICY CONSIDERATION: The Criminal Justice Data Communications Network maintained by the MN Bureau of Criminal Apprehension (BCA) provides important systems and tools for our police department and prosecutors office. Does Council wish to authorize renewal of an agreement which will permit continued access to this network? SUMMARY: Criminal justice agencies throughout Minnesota maintain a cooperative relationship with each other and the Minnesota BCA through the ability to collect and share data via a common repository maintained by the BCA. In St. Louis Park, our police department and city prosecutor have relied upon this relationship for many years to assist in effectively managing and investigating criminal cases. The attached joint powers agreement represents our desire to renew and maintain this cooperative relationship. Through this agreement, we agree to adhere to the requirements and limitations prescribed by the BCA and Minnesota law related to data practices. The term of the agreement is five years. FINANCIAL OR BUDGET CONSIDERATION: The joint powers agreement identifies the cost of this access to be $510.00 per quarter, and this cost is accounted for in our annual budget and planning process. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Resolution Contract Prepared by: Michael Harcey, Chief of Police Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 4j) Page 2 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota RESOLUTION NO. 17-____ RESOLUTION APPROVING STATE OF MINNESOTA JOINT POWERS AGREEMENT WITH THE CITY OF ST. LOUIS PARK ON BEHALF OF ITS CITY ATTORNEY AND POLICE DEPARTMENT WHEREAS, the City of St. Louis Park on behalf of its Prosecuting Attorney and Police Department desires to enter into Joint Powers Agreement with the State of Minnesota, Department of Public Safety, Bureau of Criminal Apprehension to use systems and tools available over the State’s criminal justice data communications network for which the City is eligible. The Joint Powers Agreement further provides the City with the ability to add, modify and delete connectivity, systems and tools over the five year life of the agreement and obligates the City to pay the costs for the network connection. NOW, THEREFORE, BE IT RESOLVED by the City Council of St. Louis Park, Minnesota as follows: 1. That the State of Minnesota Joint Powers Agreements by and between the State of Minnesota acting through its Department of Public Safety, Bureau of Criminal Apprehension and the City of St. Louis Park on behalf of its Prosecuting Attorney and Police Department, are hereby approved. Copies of the two Joint Powers Agreements are attached to this Resolution and made a part of it. 2. That the Chief of Police, Michael Harcey, or his successor, is designated the Authorized Representative for the Police Department. The Authorized Representative is also authorized to sign any subsequent amendment or agreement that may be required by the State of Minnesota to maintain the City’s connection to the systems and tools offered by the State. To assist the Authorized Representative with the administration of the agreement, Lieutenant Lori Dreier is appointed as the Authorized Representative’s designee. 3. That Attorney Michael Colich, or his successor, is designated the Authorized Representative for the Prosecuting Attorney. The Authorized Representative is also authorized to sign any subsequent amendment or agreement that may be required by the State of Minnesota to maintain the City’s connection to the systems and tools offered by the State. To assist the Authorized Representative with the administration of the agreement, Attorney Samuel Colich is appointed as the Authorized Representative’s designee. 4. That Jake Spano, the Mayor for the City of St. Louis Park, and Melissa Kennedy, the City Clerk, are authorized to sign the State of Minnesota Joint Powers Agreement. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk City Council Meeting of April 17, 2017 (Item No. 4j) Page 3 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota STATE OF MINNESOTA JOINT POWERS AGREEMENT AUTHORIZED AGENCY This agreement is between the State of Minnesota, acting through its Department of Public Safety, Bureau of Criminal Apprehension ("BCA") and the City of St. Louis Park on behalf of its Police Department ("Agency"). Recitals Under Minn. Stat. § 471.59, the BCA and the Agency are empowered to engage in those agreements that are necessary to exercise their powers. Under Minn. Stat. § 299C.46 the BCA must provide a criminal justice data communications network to benefit authorized agencies in Minnesota. The Agency is authorized by law to utilize the criminal justice data communications network pursuant to the terms set out in this agreement. In addition, BCA either maintains repositories of data or has access to repositories of data that benefit authorized agencies in performing their duties. Agency wants to access these data in support of its official duties. The purpose of this Agreement is to create a method by which the Agency has access to those systems and tools for which it has eligibility, and to memorialize the requirements to obtain access and the limitations on the access. Agreement 1 Term of Agreement 1.1 Effective date: This Agreement is effective on the date the BCA obtains all required signatures under Minn. Stat. § 16C.05, subdivision 2. 1.2 Expiration date: This Agreement expires five years from the date it is effective. 2 Agreement between the Parties 2.1 General access. BCA agrees to provide Agency with access to the Minnesota Criminal Justice Data Communications Network (CJDN) and those systems and tools which the Agency is authorized by law to access via the CJDN for the purposes outlined in Minn. Stat. § 299C.46. 2.2 Methods of access. The BCA offers three (3) methods of access to its systems and tools. The methods of access are: A. Direct access occurs when individual users at the Agency use Agency’s equipment to access the BCA’s systems and tools. This is generally accomplished by an individual user entering a query into one of BCA’s systems or tools. B. Indirect access occurs when individual users at the Agency go to another Agency to obtain data and information from BCA’s systems and tools. This method of access generally results in the Agency with indirect access obtaining the needed data and information in a physical format like a paper report. C. Computer-to-computer system interface occurs when Agency’s computer exchanges data and information with BCA’s computer systems and tools using an interface. Without limitation, interface types include: state message switch, web services, enterprise service bus and message queuing. For purposes of this Agreement, Agency employees or contractors may use any of these methods to use BCA’s systems and tools as described in this Agreement. Agency will select a method of access and can change the methodology following the process in Clause 2.10. City Council Meeting of April 17, 2017 (Item No. 4j) Page 4 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota 2.3 Federal systems access. In addition, pursuant to 28 CFR §20.30-38 and Minn. Stat. §299C.58, BCA may provide Agency with access to the Federal Bureau of Investigation (FBI) National Crime Information Center. 2.4 Agency policies. Both the BCA and the FBI’s Criminal Justice Information Systems (FBI-CJIS) have policies, regulations and laws on access, use, audit, dissemination, hit confirmation, logging, quality assurance, screening (pre-employment), security, timeliness, training, use of the system, and validation. Agency has created its own policies to ensure that Agency’s employees and contractors comply with all applicable requirements. Agency ensures this compliance through appropriate enforcement. These BCA and FBI-CJIS policies and regulations, as amended and updated from time to time, are incorporated into this Agreement by reference. The policies are available at https://app.dps.mn.gov/cjdn. 2.5 Agency resources. To assist Agency in complying with the federal and state requirements on access to and use of the various systems and tools, information is available at https://sps.x.state.mn.us/sites/bcaservicecatalog/default.aspx. Additional information on appropriate use is found in the Minnesota Bureau of Criminal Apprehension Policy on Appropriate Use of Systems and Data available at https://dps.mn.gov/divisions/bca/bca-divisions/mnjis/Documents/BCA- Policy-on-Appropriate-Use-of-Systems-and-Data.pdf. 2.6 Access granted. A. Agency is granted permission to use all current and future BCA systems and tools for which Agency is eligible. Eligibility is dependent on Agency (i) satisfying all applicable federal or state statutory requirements; (ii) complying with the terms of this Agreement; and (iii) acceptance by BCA of Agency’s written request for use of a specific system or tool. B. To facilitate changes in systems and tools, Agency grants its Authorized Representative authority to make written requests for those systems and tools provided by BCA that the Agency needs to meet its criminal justice obligations and for which Agency is eligible. 2.7 Future access. On written request by Agency, BCA also may provide Agency with access to those systems or tools which may become available after the signing of this Agreement, to the extent that the access is authorized by applicable state and federal law. Agency agrees to be bound by the terms and conditions contained in this Agreement that when utilizing new systems or tools provided under this Agreement. 2.8 Limitations on access. BCA agrees that it will comply with applicable state and federal laws when making information accessible. Agency agrees that it will comply with applicable state and federal laws when accessing, entering, using, disseminating, and storing data. Each party is responsible for its own compliance with the most current applicable state and federal laws. 2.9 Supersedes prior agreements. This Agreement supersedes any and all prior agreements between the BCA and the Agency regarding access to and use of systems and tools provided by BCA. 2.10 Requirement to update information. The parties agree that if there is a change to any of the information whether required by law or this Agreement, the party will send the new information to the other party in writing within 30 days of the change. This clause does not apply to changes in systems or tools provided under this Agreement. This requirement to give notice additionally applies to changes in the individual or organization serving a city as its prosecutor. Any change in performance of the prosecutorial function must be provided to the BCA in writing by giving notice to the Service Desk, BCA.ServiceDesk@state.mn.us. 2.11 Transaction record. The BCA creates and maintains a transaction record for each exchange of data utilizing its systems and tools. In order to meet FBI-CJIS requirements and to perform the audits City Council Meeting of April 17, 2017 (Item No. 4j) Page 5 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota described in Clause 7, there must be a method of identifying which individual users at the Agency conducted a particular transaction. If Agency uses either direct access as described in Clause 2.2A or indirect access as described in Clause 2.2B, BCA’s transaction record meets FBI-CJIS requirements. When Agency’s method of access is a computer to computer interface as described in Clause 2.2C, the Agency must keep a transaction record sufficient to satisfy FBI-CJIS requirements and permit the audits described in Clause 7 to occur. If an Agency accesses data from the Driver and Vehicle Services Division in the Minnesota Department of Public Safety and keeps a copy of the data, Agency must have a transaction record of all subsequent access to the data that are kept by the Agency. The transaction record must include the individual user who requested access, and the date, time and content of the request. The transaction record must also include the date, time and content of the response along with the destination to which the data were sent. The transaction record must be maintained for a minimum of six (6) years from the date the transaction occurred and must be made available to the BCA within one (1) business day of the BCA’s request. 2.12 Court information access. Certain BCA systems and tools that include access to and/or submission of Court Records may only be utilized by the Agency if the Agency completes the Court Data Services Subscriber Amendment, which upon execution will be incorporated into this Agreement by reference. These BCA systems and tools are identified in the written request made by Agency under Clause 2.6 above. The Court Data Services Subscriber Amendment provides important additional terms, including but not limited to privacy (see Clause 8.2, below), fees (see Clause 3 below), and transaction records or logs, that govern Agency’s access to and/or submission of the Court Records delivered through the BCA systems and tools. 2.13 Vendor personnel screening. The BCA will conduct all vendor personnel screening on behalf of Agency as is required by the FBI CJIS Security Policy. The BCA will maintain records of the federal, fingerprint-based background check on each vendor employee as well as records of the completion of the security awareness training that may be relied on by the Agency. 3 Payment The Agency agrees to pay BCA for access to the criminal justice data communications network described in Minn. Stat. § 299C.46 as specified in this Agreement. The bills are sent quarterly for the amount of Five Hundred Ten Dollars ($510.00) or a total annual cost of Two Thousand Forty Dollars ($2,040.00). Agency will identify its contact person for billing purposes, and will provide updated information to BCA’s Authorized Representative within ten business days when this information changes. If Agency chooses to execute the Court Data Services Subscriber Amendment referred to in Clause 2.12 in order to access and/or submit Court Records via BCA’s systems, additional fees, if any, are addressed in that amendment. 4 Authorized Representatives The BCA's Authorized Representative is Dana Gotz, Department of Public Safety, Bureau of Criminal Apprehension, Minnesota Justice Information Services, 1430 Maryland Avenue, St. Paul, MN 55106, 651-793-1007, or her successor. The Agency's Authorized Representative is Chief Michael Harcey, 3015 Raleigh Avenue S, St. Louis Park, MN 55416, (952) 924-2600, or his/her successor. 5 Assignment, Amendments, Waiver, and Contract Complete City Council Meeting of April 17, 2017 (Item No. 4j) Page 6 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota 5.1 Assignment. Neither party may assign nor transfer any rights or obligations under this Agreement. 5.2 Amendments. Any amendment to this Agreement, except those described in Clauses 2.6 and 2.7 above must be in writing and will not be effective until it has been signed and approved by the same parties who signed and approved the original agreement, their successors in office, or another individual duly authorized. 5.3 Waiver. If either party fails to enforce any provision of this Agreement, that failure does not waive the provision or the right to enforce it. 5.4 Contract Complete. This Agreement contains all negotiations and agreements between the BCA and the Agency. No other understanding regarding this Agreement, whether written or oral, may be used to bind either party. 6 Liability Each party will be responsible for its own acts and behavior and the results thereof and shall not be responsible or liable for the other party’s actions and consequences of those actions. The Minnesota Torts Claims Act, Minn. Stat. § 3.736 and other applicable laws govern the BCA’s liability. The Minnesota Municipal Tort Claims Act, Minn. Stat. Ch. 466, governs the Agency’s liability. 7 Audits 7.1 Under Minn. Stat. § 16C.05, subd. 5, the Agency’s books, records, documents, internal policies and accounting procedures and practices relevant to this Agreement are subject to examination by the BCA, the State Auditor or Legislative Auditor, as appropriate, for a minimum of six years from the end of this Agreement. Under Minn. Stat. § 6.551, the State Auditor may examine the books, records, documents, and accounting procedures and practices of BCA. The examination shall be limited to the books, records, documents, and accounting procedures and practices that are relevant to this Agreement. 7.2 Under applicable state and federal law, the Agency’s records are subject to examination by the BCA to ensure compliance with laws, regulations and policies about access, use, and dissemination of data. 7.3 If Agency accesses federal databases, the Agency’s records are subject to examination by the FBI and Agency will cooperate with FBI examiners and make any requested data available for review and audit. 7.4 To facilitate the audits required by state and federal law, Agency is required to have an inventory of the equipment used to access the data covered by this Agreement and the physical location of each. 8 Government Data Practices 8.1 BCA and Agency. The Agency and BCA must comply with the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, as it applies to all data accessible under this Agreement, and as it applies to all data created, collected, received, stored, used, maintained, or disseminated by the Agency under this Agreement. The remedies of Minn. Stat. §§ 13.08 and 13.09 apply to the release of the data referred to in this clause by either the Agency or the BCA. 8.2 Court Records. If Agency chooses to execute the Court Data Services Subscriber Amendment referred to in Clause 2.12 in order to access and/or submit Court Records via BCA’s systems, the following provisions regarding data practices also apply. The Court is not subject to Minn. Stat. Ch. 13 (see section 13.90) but is subject to the Rules of Public Access to Records of the Judicial Branch promulgated by the Minnesota Supreme Court. All parties acknowledge and agree that Minn. Stat. § 13.03, subdivision 4(e) requires that the BCA and the Agency comply with the Rules of Public Access for those data received from Court under the Court Data Services Subscriber Amendment. All parties also acknowledge and agree that the use of, access to or submission of Court Records, as that term is defined in the Court Data Services Subscriber Amendment, may be restricted by rules promulgated by the Minnesota Supreme Court, applicable state statute or federal law. All parties acknowledge and agree that these applicable restrictions must be followed in the appropriate circumstances. City Council Meeting of April 17, 2017 (Item No. 4j) Page 7 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota 9 Investigation of alleged violations; sanctions For purposes of this clause, “Individual User” means an employee or contractor of Agency. 9.1 Investigation. Agency and BCA agree to cooperate in the investigation and possible prosecution of suspected violations of federal and state law referenced in this Agreement. Agency and BCA agree to cooperate in the investigation of suspected violations of the policies and procedures referenced in this Agreement. When BCA becomes aware that a violation may have occurred, BCA will inform Agency of the suspected violation, subject to any restrictions in applicable law. When Agency becomes aware that a violation has occurred, Agency will inform BCA subject to any restrictions in applicable law. 9.2 Sanctions Involving Only BCA Systems and Tools. The following provisions apply to BCA systems and tools not covered by the Court Data Services Subscriber Amendment. None of these provisions alter the Agency’s internal discipline processes, including those governed by a collective bargaining agreement. 9.2.1 For BCA systems and tools that are not covered by the Court Data Services Subscriber Amendment, Agency must determine if and when an involved Individual User’s access to systems or tools is to be temporarily or permanently eliminated. The decision to suspend or terminate access may be made as soon as alleged violation is discovered, after notice of an alleged violation is received, or after an investigation has occurred. Agency must report the status of the Individual User’s access to BCA without delay. BCA reserves the right to make a different determination concerning an Individual User’s access to systems or tools than that made by Agency and BCA’s determination controls. 9.2.2 If BCA determines that Agency has jeopardized the integrity of the systems or tools covered in this Clause 9.2, BCA may temporarily stop providing some or all the systems or tools under this Agreement until the failure is remedied to the BCA’s satisfaction. If Agency’s failure is continuing or repeated, Clause 11.1 does not apply and BCA may terminate this Agreement immediately. 9.3 Sanctions Involving Only Court Data Services The following provisions apply to those systems and tools covered by the Court Data Services Subscriber Amendment, if it has been signed by Agency. As part of the agreement between the Court and the BCA for the delivery of the systems and tools that are covered by the Court Data Services Subscriber Amendment, BCA is required to suspend or terminate access to or use of the systems and tools either on its own initiative or when directed by the Court. The decision to suspend or terminate access may be made as soon as an alleged violation is discovered, after notice of an alleged violation is received, or after an investigation has occurred. The decision to suspend or terminate may also be made based on a request from the Authorized Representative of Agency. The agreement further provides that only the Court has the authority to reinstate access and use. 9.3.1 Agency understands that if it has signed the Court Data Services Subscriber Amendment and if Agency’s Individual Users violate the provisions of that Amendment, access and use will be suspended by BCA or Court. Agency also understands that reinstatement is only at the direction of the Court. 9.3.2 Agency further agrees that if Agency believes that one or more of its Individual Users have violated the terms of the Amendment, it will notify BCA and Court so that an investigation as described in Clause 9.1 may occur. 10 Venue Venue for all legal proceedings involving this Agreement, or its breach, must be in the appropriate state or federal court with competent jurisdiction in Ramsey County, Minnesota. 11 Termination City Council Meeting of April 17, 2017 (Item No. 4j) Page 8 Title: Criminal Justice Data Communications Network Joint Powers Agreement with State of Minnesota 11.1 Termination. The BCA or the Agency may terminate this Agreement at any time, with or without cause, upon 30 days’ written notice to the other party’s Authorized Representative. 11.2 Termination for Insufficient Funding. Either party may immediately terminate this Agreement if it does not obtain funding from the Minnesota Legislature, or other funding source; or if funding cannot be continued at a level sufficient to allow for the payment of the services covered here. Termination must be by written notice to the other party’s authorized representative. The Agency is not obligated to pay for any services that are provided after notice and effective date of termination. However, the BCA will be entitled to payment, determined on a pro rata basis, for services satisfactorily performed to the extent that funds are available. Neither party will be assessed any penalty if the agreement is terminated because of the decision of the Minnesota Legislature, or other funding source, not to appropriate funds. Notice of the lack of funding must be provided within a reasonable time of the affected party receiving that notice. 12 Continuing obligations The following clauses survive the expiration or cancellation of this Agreement: 6. Liability; 7. Audits; 8. Government Data Practices; 9. Investigation of alleged violations; sanctions; and 10.Venue. The parties indicate their agreement and authority to execute this Agreement by signing below. 1. AGENCY Name: _____________________________________________ (PRINTED) Signed: ____________________________________________ Title: ______________________________________________ (with delegated authority) Date: ______________________________________________ Name: _____________________________________________ (PRINTED) Signed: ____________________________________________ Title: ______________________________________________ (with delegated authority) Date: ______________________________________________ 2. DEPARTMENT OF PUBLIC SAFETY, BUREAU OF CRIMINAL APPREHENSION Name: _____________________________________________ (PRINTED) Signed: ____________________________________________ Title: ______________________________________________ (with delegated authority) Date: ______________________________________________ 3. COMMISSIONER OF ADMINISTRATION delegated to Materials Management Division By: ______________________________________________ Date: _____________________________________________ Meeting: City Council Meeting Date: April 17, 2017 Consent Agenda Item: 4k OFFICIAL MINUTES PLANNING COMMISSION ST. LOUIS PARK, MINNESOTA MARCH 8, 2017 – 6:00 p.m. COUNCIL CHAMBERS MEMBERS PRESENT: Claudia Johnston-Madison, Lisa Peilen, Carl Robertson, Joe Tatalovich, Ethan Rickert (youth member) MEMBERS ABSENT: Lynne Carper, Torrey Kanne, Richard Person STAFF PRESENT: Jennifer Monson, Gary Morrison, Sean Walther OTHERS PRESENT: Soren Mattick, City Attorney 1. Call to Order – Roll Call 2. Approval of Minutes of February 1, 2017 Commissioner Robertson made a motion to approve the minutes of February 1, 2017. Commissioner Johnston-Madison made a motion to second the minutes, and the motion failed on a vote of 2-0-2 (Peilen and Johnston-Madison abstained). 3. Public Hearings A. Knollwood Mall Preliminary and Final PUD Location: 8332 Highway 7 Applicant: Chick-fil-A Inc. Case No.: 17-08-PUD Gary Morrison, Assistant Zoning Administrator, presented the staff report. He explained that the PUD request is two-fold to convert the existing Knollwood Mall PUD to the current PUD format and to redevelop the existing TCF bank building with in-vehicle service (drive-thru) into a proposed Chick-fil-A (CFA) restaurant with a drive-thru. Mr. Morrison presented drive-thru and traffic flow comparisons for the TCF site and the proposed CFA development. Mr. Morrison reviewed parking, stormwater, landscaping, lighting, signage and architecture. Mr. Morrison stated that a neighborhood meeting was held on February 22, 2017. Concerns included traffic levels on Texas Ave., lighting levels affecting residents east of Texas Ave., and concerns about CFA as a company. City Council Meeting of April 17, 2017 (Item No. 4k) Page 2 Title: Planning Commission Meeting Minutes of March 8, 2017 Commissioner Johnston-Madison asked about access on Texas, remarking that it was a quick right turn. Mr. Morrison showed the access. Commissioner Robertson asked if the boundary on the new PUD is the same as the existing PUD boundary. Mr. Morrison replied that the boundary is the same. Commissioner Rickert asked about the drive-thru lanes, order stations, parking lot and footprint. Mr. Morrison showed the drawings and the proposed new footprint. Commissioner Tatalovich asked about the expectation for traffic flow coming west on Hwy. 7 to the property. Mr. Morrison responded that it will probably be a split between the main Knollwood entrance and the Texas entrance. Mr. Morrison described the drive-thru double stacking lane that accommodates several cars and would eliminate back up into the parking lot. Jason Hill, development consultant for CFA, and Joe Vavrina, HR Green, introduced themselves. Mr. Hill provided background on the company and its locations. He noted that CFA allows one franchise per person. Joe Vavrina, HR Green, discussed conditions No. 7. Lighting and No. 8 Landscaping. He said the lighting they’ve requested is paramount for safety. He said their request is to work with staff to be flexible and allow lighting in excess of city code. He added that the lighting will be LED. Regarding landscaping, Mr. Vavrina said CFA wants to remove trees which MnDOT recommended removing based on quality of the tree. MnDOT identified two other trees in declining health and at risk to the right-of-way. He circulated photographs of trees which CFA would like to remove under the advice of their arborist and MnDOT. Mr. Vavrina said MnDOT has agreed to allow trees to be replanted in the right-of-way to compensate for trees removed. Chair Peilen opened the public hearing. Ellen Dischinger, Stacey Aldrich, Susan Niz and Marc Berg presented a letter with 105 signatures, dated March 8, 2017, to Commissioners and the applicant, on behalf of Allies of St. Louis Park. Ellen Dischinger, 3266 Blackstone Ave. S. read their letter to CFA which stated Allies of St. Louis Park’s mission is to stand up for groups and individuals who feel threatened in the current climate, including the LGBTQIA community. City Council Meeting of April 17, 2017 (Item No. 4k) Page 3 Title: Planning Commission Meeting Minutes of March 8, 2017 Susan Niz, 2800 Alabama Ave. S., asked if CFA would consider a gender-neutral restroom or restrooms in the restaurant. She stated that voluntarily adding them to the restaurant would be a proactive way for a new business to show support to the LGBTQIA community. Stacey Aldrich, 2757 Alabama Ave. S., read the city’s Resolution Supporting and Standing with all Members of the St. Louis Park Community. Ms. Aldrich asked if CFA would evaluate hiring practices to ensure they are free of institutional racism, homophobia, transphobia and sexism. She asked if CFA would reach out to disabled workers and to immigrants. Ms. Aldrich asked if CFA would make accommodations to support the religious practices of employees. She asked if CFA can share some examples of how they will actively address those issues. Marc Berg, 2913 Webster Ave. S., said he expected to hear about technical issues from the applicant. He said what he heard right away was about what a wonderful company Chick-fil-A is. He stated that paragraph one of the City Charter preamble addresses the city’s strong position and tradition with respect to human rights, anti-discrimination, tolerance, diversity and inclusion. He said the Allies group wants to emphasize that St. Louis Park takes human rights seriously. He said St. Louis Park is a community in which businesses tend to be engaged with the community. Mr. Berg asked if CFA would work towards a more inclusive community, one that denounces bigotry, hatred and intolerance. He asked if CFA would share how its profits are invested and what charitable contributions it will make. Zaylore Stout, 2957 Vernon Ave. S., stated that he is a labor and employment law attorney. He said there have been lawsuits against CFA franchises in regards to requiring prayer at some employee meetings and at some management level meetings. He asked if this is going to be a practice in St. Louis Park as well. He asked if Muslims will be welcome as employees and to grow within the organization into management positions; and in management and corporate training would they also be required to pray Christian prayers. He asked if they will be penalized or terminated if they choose not to. Mr. Stout said he subscribes and believes in the comments made by the Allies of St. Louis Park in regards to the LGBTQIA community. Karl Gamradt, 3347 Virginia Ave. S., said it seems there is no agreement on the lighting or landscape plan. He commented that there already are issues with existing lighting and this was discussed at the neighborhood meeting. The new plans include more lighting than the city wants. The sign would also be lit. He said that’s a lot of lighting going up when there are already lighting issues. Mr. Gamradt spoke about traffic concerns entering and exiting the site; and the uncontrolled intersection at the northeast corner. He said given the nature of fast food traffic the traffic flow seems like a big problem with a lot of opportunity for accidents. Mr. Gamradt stated one has to be careful about separating oneself from the corporation in terms of the immediate franchisee. The local hiring practices may be fine but institutional racism is almost impossible to detect even when it exists. In terms of charitable giving, Mr. Gamradt said he appreciates the applicant showing what CFA has done in the past. City Council Meeting of April 17, 2017 (Item No. 4k) Page 4 Title: Planning Commission Meeting Minutes of March 8, 2017 He said the applicant has said CFA can’t guarantee what the franchisee will support in charitable giving. Chair Peilen closed the public hearing. Mr. Hill stated that CFA is a restaurant company dedicated to making good food and making remarkable service for all customers. He said the company is represented by more than 80,000 people, at over 2100 locations, who have diverse opinions, backgrounds and beliefs. He said as a representative of CFA he doesn’t have answers for all the questions asked. He said he will get the contact information of the public hearing speakers so he is able to provide as many answers as he can. He added that there are 10- 12 CFA restaurants in the Twin Cities. Chair Peilen commented that the recommended conditions regarding lighting and landscaping as presented by staff are quite clear to the Commission. The applicant may not be in full agreement with staff. She added that traffic analysis was also an important part of the work which has been completed by staff. Mr. Morrison responded that considerable traffic changes were made to the original site plan in the name of traffic and safety. He said staff believes that the site plan now is more than adequate to handle traffic at the site. The U-turns are safe. Commissioner Robertson said he wanted lighting and landscaping plans to meet city requirements. He said the Planning Commission looks at zoning. Discussion and comments made at the public hearing will be in the record and reviewed by City Council. He said most of the other issues raised need to be addressed by someone other than a volunteer Planning Commission. He said he would recommend approval with great respect for the worries that have been expressed at the public hearing. Commissioner Tatalovich said he agreed with Commissioner Robertson. He said he agrees with comments made in the public hearing. CFA could have a very successful franchise in the city but it will never be fully embraced unless they do things as laid out by the Allies. Commissioner Johnston-Madison said she agrees with Commissioners Robertson and Tatalovich. Regarding traffic, she said there is a similar situation at McDonalds near Miracle Mile. She said the proposed traffic flow at CFA is much better than McDonalds. She said that drivers do learn how to yield and turn at drive-thru facilities. It does work at McDonalds which is much more congested. She thanked everyone for their participation in the public hearing. Chair Peilen said she agreed with the comments made by commissioners. She thanked the Allies of St. Louis Park for their commitment and said it is important for a company to succeed in St. Louis Park to be aware of concerns. She said there’s no basis for the Planning Commission to make a decision on the plan based on a company’s philosophy. She added that the Allies have done a great service by their presence. City Council Meeting of April 17, 2017 (Item No. 4k) Page 5 Title: Planning Commission Meeting Minutes of March 8, 2017 Commissioner Robertson made a motion recommending approval of the Preliminary and Final Shoppes at Knollwood PUD subject to conditions, and rezoning the Knollwood PUD properties to the Shoppes at Knollwood PUD. Commissioner Johnston-Madison requested a friendly amendment that any diseased trees be removed and replaced, and not just staff’s recommendations to keep all but one tree. Commissioner Robertson accepted the friendly amendment and Chair Peilen seconded the motion. The motion passed on a vote of 4-0. B. Stormwater Capture and Reuse System – Conditional Use Permit Location: 3520 Xenwood Avenue S. Applicant: Douglas Corporation Case No.: 17-03-CUP Jennifer Monson, Planner, presented the staff report. She explained that the applicant has applied for the conditional use permit to excavate 2,150 cubic yards of soil to construct an underground stormwater capture and reuse system. She noted that proposed plans for the CUP will bring the site closer to zoning compliance as much as possible. Ms. Monson stated that in 2008 Douglas Corp., a metal-plating company, was identified as a source of pollution contaminating Lake Calhoun. She said since that time Douglas Corp. has been working with the MPCA to replace the roof, roof vents, tanks and other structures, but there are still traces of pollution on the property contaminating stormwater runoff. The applicant proposes to construct an underground stormwater capture, filter and reuse system to reduce the concentration of chemicals having an impact on Lake Calhoun. Ms. Monson reviewed excavation details, construction details, landscaping, parking requirements, and bike rack revision. Commissioner Johnston-Madison asked if chemicals have been found on other roofs in the area. John Fudala, applicant, gave background on the chemicals which are PFCs. He said once Douglas Corp. found out the materials they were purchasing contained PFCs compound they began substituting with non-PCF products. He said the roof of the building was the area that the MPCA was most concerned with regarding contamination. Douglas Corp. replaced the roof down to the decking with the desire to reduce the concentration of contamination in the stormwater. Douglas Corp. also replaced all of the chemical baths that the product was used in. Mr. Fudala said Douglas Corporation’s goal is to stop the stormwater contamination by capturing runoff from the property before it leaves the site. This improvement is supported by the MPCA. He said they have negotiated in good faith with the MPCA throughout the process. They’ve done everything MPCA has asked them to do. Mr. Fudala said roof discharge of other buildings in the immediate area has not been sampled by Douglas Corp. City Council Meeting of April 17, 2017 (Item No. 4k) Page 6 Title: Planning Commission Meeting Minutes of March 8, 2017 Commissioner Rickert asked why the company waited until 2017 to take on construction of stormwater capture and reuse. Mr. Fudala said the company switched to non-PCP chemistry as quickly as they could. They thought once they replaced the roof the concentrations would be down to 0. When they replaced all process solutions they thought that would do it. He stated that there was nothing left to replace so they needed to redirect the discharge. Chair Peilen opened the public hearing. As no one was present wishing to speak she closed the public hearing. Commissioner Robertson made a motion recommending approval of the Conditional Use Permit with conditions. Commissioner Tatalovich seconded the motion, and the motion passed on a vote of 4-0. 4. Other Business 5. Communications Sean Walther, Planning and Zoning Supervisor, said the PLACE public hearing for Comprehensive Plan amendment, PUD and Plat will be held on March 15. He discussed the availability of the PLACE Environmental Assessment Worksheet (EAW), how to view copies of the EAW, the comment period deadline, and the procedures for submitting written comments. Mr. Walther provided updates on upcoming Vision 3.0 events. Mr. Walther said the State of the City event will be held on March 23. Commissioner Tatalovich discussed STEP’s Empty Bowls event to be held on March 9. 6 Adjournment The meeting was adjourned at 7:30 pm Respectfully submitted, Nancy Sells Recording Secretary Meeting: City Council Meeting Date: April 17, 2017 Public Hearing Agenda Item: 6a EXECUTIVE SUMMARY TITLE: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements RECOMMENDED ACTION: Mayor to open public hearing, take public testimony, and close public hearing. Motion to approve the first reading of an ordinance amending the St. Louis Park Home Rule Charter related to Municipal Primary Elections and Candidate Filing Requirements. A unanimous vote of all 7 councilmembers is required for approval. POLICY CONSIDERATION: Does the City Council support the proposed Charter amendments related to municipal primary elections and candidate filing requirements? SUMMARY: In 2016 the City Council discussed several topics related to elections including the ranked choice voting method and the filing requirements for candidates for municipal offices. During this discussion a number of concerns were raised by the council related to municipal elections including: cost of holding primary elections, staff resources related to the administration of primary elections, historically low voter turnout at primary elections, perceived lack of serious candidates filing for municipal office, and the undue burdens placed on candidates to run campaigns for potentially both a primary and general election. At that time the consensus of the Council was that a switch to the ranked choice voting method was not warranted, primarily because the school district does not have the option to switch voting methods, and it was thought that other measures could be taken to address the identified concerns. Staff was directed to refer the issue to the Charter Commission for a recommendation on a potential amendment to the Charter. The Charter Commission met on February 22, 2017 to discuss the questions and concerns of the council. Following considerable discussion, the Charter Commission made a formal recommendation to present a Charter amendment to the City Council for consideration. The proposed amendment would achieve the following objectives: - Eliminate the need to hold a municipal primary election when 3 or more candidates file for any city office. All candidates filing for municipal offices would be placed on the General Election ballot. - Amend the filing requirements for candidates for municipal office to increase the number of signatures required on a nominating petition from 15 to 50. The notice of public hearing, including the text of the proposed amendment, was published on March 23, 2017 in the Sun Sailor. FINANCIAL OR BUDGET CONSIDERATION: Eliminating the need for a primary will provide savings to the City equal to approximately $1,000/precinct, plus significant staff time. SUPPORTING DOCUMENTS: Discussion Draft Ordinance Charter Commission Meeting Minutes of February 22, 2017 Prepared by: Melissa Kennedy, City Clerk Reviewed by: Nancy Deno, Deputy City Manager/HR Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 6a) Page 2 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements DISCUSSION Is the City required to hold Municipal Primary Elections? Minnesota Election Law states municipal primary elections may be held in any city. As a home rule charter city, St. Louis Park has chosen to hold a Municipal Primary Election whenever three (3) or more candidates file for any elective City office. Primary Elections are held in accordance with the provisions contained in Section 4.03 of the City Charter. Does the school district hold primary elections? Minnesota Election Law also affords school districts the option to choose whether or not to hold primary elections. The St. Louis Park School District has chosen not to hold primary elections for School Board offices. This means that all candidates filing for a School Board office appear on the General Election ballot. How many other cities in Hennepin County hold Municipal Primary Elections? Of the 45 cities in Hennepin County, only 11 cities have the option to hold municipal primary elections (Bloomington, Brooklyn Center, Brooklyn Park, Crystal, Dayton, Independence, Minnetonka, Richfield, Robbinsdale, Rogers, and St. Louis Park). The remaining 34 cities do not hold municipal primaries. How many Municipal Primary Elections have been held in St. Louis Park? 9 Municipal Primary Elections have been required in St. Louis Park since 1975. 7 primaries involved only 1 or 2 wards 2 primaries were citywide How many candidates have filed for City offices in the previous 3 municipal elections? • 2015: 4 candidates for Mayor, 1 candidate for Councilmember At-Large A, 2 candidates for Councilmember At-Large B • 2013: 1 candidate for Ward 1 Councilmember, 1 candidate for Ward 2 Councilmember, 3 candidates for Ward 3 Councilmember, 2 candidates for Ward 4 Councilmember • 2011: 1 candidate for Mayor, 2 candidates for Councilmember At-Large A, 3 candidates for Councilmember At-Large B What are the current requirements for candidates filing for office in St. Louis Park? Candidates are required to pay a $20 filing fee in addition to submitting a nomination petition signed by at least 15 currently registered electors qualified to vote for the office specified on the petition. Is there a limit to what the City can charge candidates filing for a municipal office? Candidate filing fees are governed by Minnesota Statute 205.13, Subd. 3. A home rule charter city that sets filing fees by authority provided in city charter is not subject to the fee limits imposed by statute. When would candidate filing take place if the proposed changes were adopted? • If the proposed changes were adopted the election cycle calendar would be pushed back. Candidate filing would occur in August of odd-numbered years. These dates would coincide with the calendar the school district follows for school board elections. • If no changes were made, candidate filing would occur in May of odd-numbered years. City Council Meeting of April 17, 2017 (Item No. 6a) Page 3 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements What are the candidate filing requirements in neighboring cities? City Filing Fee Nominating Petition? Primary Election Option? Even/Odd Year Elections St. Louis Park $20 Yes Yes Odd Edina $5 No No Even Hopkins $25 No No Odd Minnetonka $5 No Yes Odd Golden Valley $5 No No Odd Richfield $25 Yes Yes Even Eden Prairie $5 No No Even Plymouth $5 No No Even Bloomington $50 No Yes Odd Minneapolis Mayor = $500; Council = $250 No No Odd What costs and resources are associated with running a Municipal Primary Election? • Municipal Primary Elections cost approximately $1,000 per precinct for Election-Day activities. This results in an estimated total of $16,000. • Additionally, in order to hold a Primary Election, staff must devote time and resources to do the following: Administer the required 46-day absentee voting period (including HCF outreach) Test equipment (Automarks & DS200 Voting Machines) Program new electronic poll books and prepare for deployment Train election judges (Equipment & Forms/Procedures Training) Prepare and deliver supply boxes and equipment to precincts and pick-up after election What is the process to amend the City Charter? In the past, amendments to the City Charter have been enacted by ordinance in accordance with the procedure outlined in M.S. § 410.12, Subd. 7. Amendment by Ordinance. “Upon recommendation of the charter commission the city council may enact a charter amendment by ordinance. Within one month of receiving a recommendation to amend the charter by ordinance, the city must publish notice of a public hearing on the proposal and the notice must contain the text of the proposed amendment. The city council must hold the public hearing on the proposed charter amendment at least two weeks but not more than one month after the notice is published. Within one month of the public hearing, the city council must vote on the proposed charter amendment ordinance. The ordinance is enacted if it receives an affirmative vote of all members of the city council and is approved by the mayor and published as in the case of other ordinances. An ordinance amending a city charter shall not become effective until 90 days after passage and publication or at such later date as is fixed in the ordinance. Within 60 days after passage and publication of such an ordinance, a petition requesting a referendum on the ordinance may be filed with the city clerk. The petition must be signed by registered voters equal in number to at least five percent of the registered voters in the city or 2,000, whichever is less. If the requisite petition is filed within the prescribed period, the ordinance shall not become effective until it is approved by the voters as in the case of charter amendments submitted by the charter commission, the council, or by petition of the voters, except that the council may submit the ordinance at any general or special election held at least 60 days after submission of the petition, or it may reconsider its action in adopting the ordinance. As far as practicable the requirements of subdivisions 1 to 3 apply to petitions submitted under this section, to an ordinance amending a charter, and to the filing of such ordinance when approved by the voters.” City Council Meeting of April 17, 2017 (Item No. 6a) Page 4 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements Can the City Council make changes to the proposed Charter amendment? Because statute requires that the notice of the public hearing include the proposed text of the amendment, the council must vote on the amendment as presented. What is the timeline for the proposed amendment to take effect? • 3/23 Notice of Hearing Published • 4/17 Public Hearing/First Reading of Ordinance • 5/15 Second Reading of Ordinance • 5/18 Ordinance Published • 7/17 60-day deadline (for petition) • 8/16 Ordinance Effective Date (90 days after Passage and Publication) Charter Commission Recommendation On February 22, 2017 the Charter Commission made the following recommendations: • Amend the Charter to eliminate the option for municipal primary elections. • Amend the filing requirements for candidates for municipal office to increase the number of signatures required on a nominating petition from 15 to 50. • Leave the candidate filing fee at the current amount of $20. The Charter Commission discussed several options for changing the candidate filing requirements including requiring candidates to obtain 100 signatures on a nominating petition and increasing the filing fee to $100. Ultimately the members of the commission felt that increasing the number of signatures would have greater potential to address some of the concerns raised by council as they felt it required more effort for candidates to obtain signatures. The commission members also felt that increasing the filing fee would not have the same impact and they did not want running for office to become cost-prohibitive for prospective candidates. City Council Meeting of April 17, 2017 (Item No. 6a) Page 5 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements ORDINANCE NO. ____-17 AN ORDINANCE AMENDING THE ST. LOUIS PARK HOME RULE CHARTER SECTIONS 4.01, 4.03, 4.04, 4.05, 4.06, and 4.07 CONCERNING MUNICIPAL ELECTIONS AND CANDIDATE FILING REQUIREMENTS PREAMBLE WHEREAS, pursuant to Minn. Stat. § 410.12, Subd. 7 the Charter Commission has recommended to the City Council that the Charter be amended as provided herein; and WHEREAS, Minn. Stat. § 410.12, Subd. 7 provides that upon recommendation of the Charter Commission the City Council may enact a Charter Amendment by ordinance. THE CITY COUNCIL OF THE CITY OF ST. LOUIS PARK, MINNESOTA DOES ORDAIN: SECTION 1. The St. Louis Park Home Rule Charter Sections 4.01, 4.03, 4.04, 4.05, 4.06, and 4.07 are hereby amended by deleting stricken language and adding underscored language: Section 4.01. General Election Laws to Apply. Except as hereinafter provided, the general laws of the State of Minnesota pertaining to registration of voters and the conduct of primary and general elections shall apply for all municipal elections of such officers as are specified in this Charter. The Council shall, through ordinances adopted in compliance with such state laws and the Charter, adopt suitable and necessary regulations for the conduct of such elections. Section 4.03. Primary Elections. The Council shall, whenever three (3) or more candidates have filed for any elective City office, provide through ordinance or resolution for a primary election to be held for each such office. The primary election shall be held on the second Tuesday in August. At least two (2) weeks' notice shall be given by the Clerk of the time and places of holding such election, and of the officers to be elected, by posting a notice thereof in at least one (1) public place in each voting precinct where a primary election will be held and by publishing a notice thereof at least once in the official newspaper of the City. Failure to give such notice shall not invalidate such election. Section 4.04. 4.03. Special Elections. The Council may by resolution order a special election, fix the time, and provide the means for holding such special election. Three (3) weeks’ published notice shall be given of any special election. The procedure at such elections shall conform as nearly as possible to that herein provided for other municipal elections. Section 4.05. 4.04. Judges of Election. The Council shall at least twenty-five (25) days before each municipal election appoint at least three (3) qualified voters to be judges of elections for each precinct. Section 4.06. 4.05. Nomination by Petition. The nomination of elective officers provided for by this Charter shall be by petition. The name of any nominee shall be printed upon the ballot whenever a petition meeting the requirements specified in this Charter has been filed on the nominee's behalf with the City Clerk. Such petition shall be signed by at least fifteen (15) fifty City Council Meeting of April 17, 2017 (Item No. 6a) Page 6 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements (50) currently registered electors qualified to vote for the office specified in the petition. No elector shall sign petitions for more candidates than the number of places to be filled at the election, and should the elector do so that signature shall be void as to the petition or petitions last filed. All nomination petitions shall be filed with the City Clerk no more than eighty four 84 ninety eight (98) days nor less than seventy (70) eighty four (84) days before the second Tuesday in August before the general city election municipal general election held in November of any year. The Clerk shall prepare the ballots with names of the candidates for an office in a manner provided by ordinance. Each petition, when presented, must be accompanied by a twenty dollar ($20.00) fifty dollar ($50.00) filing fee. Section 4.07. 4.06. Nomination Petitions. The signatures to the nomination petition need not be contained on one (1) paper. Each paper shall include an affidavit of its circulator stating the number of signators and affirming that each signature was written in the circulator’s presence and is the signature of the person who signed it. The residence address of each signer shall be affixed to the petition. The nominee shall indicate acceptance of the office, if elected, by an endorsement on the petition. The form of the nomination petition shall be substantially as follows: NOMINATION PETITION We, the undersigned, electors of the City of St. Louis Park, nominate ______________, whose residence is ________________, for the office of _________________ to be voted for at the election to be held on the _________ day of ____________; and we individually certify that we are qualified electors and that we have not signed more nomination petitions of candidates for this office than there are persons to be elected. ____________ being duly sworn, deposes and says that the undersigned circulated the foregoing petition and that the signatures were made in the circulator’s presence and are the signatures of the persons who signed them. Subscribed and sworn to before me this _________ day of __________, ___________ Notary Public for Hennepin County, Minnesota This petition, if found insufficient by the City Clerk, shall be returned to ______________ at Number _________________ Street. I hereby indicate my willingness to accept the office of ___________ if duly elected. Nominee ______________ Name Street and Number -------------- ---------------------- -------------- ---------------------- Signed ____________ City Council Meeting of April 17, 2017 (Item No. 6a) Page 7 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements Section 4.08. 4.07. Canvass of Elections and Taking of Office. The Council shall meet and canvass the election returns within seven (7) days after any regular or special elections, declare the results as soon as possible, and file a statement thereof with the City Clerk. Said statement shall be made part of the minutes and shall include: (a) The total number of good ballots cast; (b) The total number of spoiled or defective ballots; (c) The vote for each candidate with a declaration of those who were elected; (d) A true copy of the ballots used; (e) The names of the judges and clerks of election; [and] (f) Such other information as may seem pertinent The City Clerk shall notify all persons elected of the fact after their election, and the persons elected shall qualify to take office at the time provided for by Section 3.01, by taking, subscribing, and filing the required oath of office with the City Clerk. SECTION 2. This Ordinance shall take effect ninety days after its publication. Date of Publication Notice of Public Hearing March 23, 2017 Public Hearing and First Reading April 17, 2017 Second Reading May 15, 2017 Date of Publication of adopted Ordinance May 18, 2017 Date Ordinance takes effect August 16, 2017 Reviewed for Administration Adopted by the City Council May 15, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Approved as to Form and Execution: Melissa Kennedy, City Clerk Soren Mattick, City Attorney City Council Meeting of April 17, 2017 (Item No. 6a) Page 8 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements OFFICIAL MINUTES CHARTER COMMISSION MEETING ST. LOUIS PARK, MINNESOTA February 22, 2017 6:00 p.m. – Westwood Room, City Hall 1. Call to Order Chair Carper called the meeting to order at 6:15 p.m. 2. Roll Call and Attendance Members Present: JC Beckstrand, Gary Carlson, Lynne Carper, Jim de Lambert, David Dyer, Brian Fiderlein, Ken Gothberg, Ron Jarvi, Jr., and Henry Solmer. Members Absent: Maren Anderson (absence excused), Jim Brimeyer (absence excused), Terry Dwyer (absence excused), Matthew Flory (absence excused), Sara Maaske (absence excused), and David Obray Others Present: Melissa Kennedy, City Clerk (staff liaison) 3. Approval of Minutes a. March 22, 2016 Charter Commission Meeting It was moved by Commissioner Beckstrand, seconded by Commissioner Dyer, to approve the minutes of March 22, 2016. The motion passed 9-0. 4. Old Business - None 5. New Business a. Proposed Charter Amendments regarding Municipal Primary Elections and Candidate Filing Requirements Ms. Kennedy reviewed the staff report that was provided in the Charter Commission agenda packet. She explained the proposed changes involved eliminating Section 4.03 of the City Charter related to Primary Elections and amending Section 4.06 to reflect the elimination of the option for municipal primary elections, adjust the filing period to match the timeframes established in state law, increase the number of signatures required on a nominating petition, and to increase the filing fee. She discussed the rationale behind the proposed amendments, citing several concerns raised by the City Council including: a history of holding primary elections for one office to narrow the field of candidates from 3 or 4 down to 2, historically low voter turnout at municipal primary elections, undue burdens placed on candidates to run campaigns for potentially both a primary and general election, lack of serious candidates filing for municipal offices, cost of holding primary elections and the devotion of staff resources related to the administration of primary elections. She noted that the council asked for input from the Charter Commission on the proposed amendments and for a recommendation on the number of signatures that should be required on a nominating petition and the cost of the filing fee. City Council Meeting of April 17, 2017 (Item No. 6a) Page 9 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements Chair Carper asked Ms. Kennedy to review the timing of the actions that would be required to amend the Charter. Ms. Kennedy explained historically amendments to the Charter have been done by ordinance. This process is regulated by Minnesota Statute 410.12. She stated within 30 days of a recommendation from the Charter Commission the City Council has to call for a public hearing to consider the proposed amendment. The public hearing must be held not less than 2 weeks and not more than 4 weeks after notice of the hearing is published. She added that the City of St. Louis Park requires two readings of an ordinance. The first reading would be held in conjunction with the public hearing and the second reading would be scheduled for a subsequent regular council meeting. She noted that the ordinance is only enacted if it receives a unanimous vote of all members of the council. The ordinance does not take effect until 90 days after passage and publication. Within 60 days of passage and publication a petition requesting a referendum on the ordinance may be filed with the city clerk. The petition must be signed by at least 2,000 registered voters in the city. If the requisite petition is filed within the 60-day period, the ordinance does not take effect until it is approved by the voters at the next general election. Ms. Kennedy noted that in addition to those deadlines the city would also be required to pass the amendment eliminating the option for municipal primary elections by April 15 in order to meet statutory notification requirements to Hennepin County elections and the Secretary of State’s Office. She stated she was working closely with the City Attorney to establish a timeline that would allow the amendment to be in effect for the 2017 election cycle. Commissioner Beckstrand stated he originally had a number of questions and concerns regarding the proposed amendment, but after a more thorough review of the information and discussions with family, friends, and the city clerk, he could not find a reason to oppose the proposed amendments. He explained he did not feel that the city would be losing anything by eliminating the option for municipal primaries. He clarified that the amendment would not apply to State or Federal elections. Chair Carper questioned when the candidate filing period would be if the proposed amendment was approved. Ms. Kennedy stated candidate filing would occur August 1-15 if the amendment was in effect for the 2017 election cycle. She added if the amendment was not in effect for this cycle candidate filing would occur May 16-May 30. She explained this is one of the questions she and the City Attorney were still exploring options on given the 60 day petition period and the 90 day effective date. She stated if the amendment was approved, the 60-day petition period would fall within the early candidate filing timeframe in May. She noted that although the proposed amendment would be in effect prior to the candidate filing dates in August, if a petition was filed the ordinance would not take effect and the city would not have the opportunity to go back and open up the candidate filing period. She added that if the city attorney and city staff did not feel there was a viable option to remediate such a situation, the recommendation would likely be that the amendment not take effect until the next municipal election cycle. Commissioner Beckstrand questioned if the city could call for a special election and set a candidate filing period if a petition was filed within the 60-day period. Ms. Kennedy stated she was not sure if that would fall within the statutory provisions related to special elections and would discuss the option with the city attorney. She noted moving forward City Council Meeting of April 17, 2017 (Item No. 6a) Page 10 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements with the amendment as proposed would not preclude anyone from filing for office, it would simply push the filing dates back to August. Commissioner Beckstrand questions if Ms. Kennedy had spoken to the Secretary of State’s Office. Ms. Kennedy stated she had received direction from the Secretary of State’s Office through the Hennepin County Deputy Elections Manager. Commissioner Fiderlein stated he was opposed to the proposed amendment to eliminate the option for municipal primary elections. He explained he did not see how the proposed amendment would solve the concerns that were raised by the council. He stated he believes that having the option for primary elections increases discussion in the community and encourages a more informed electorate. Chair Carper stated while he understands Commissioner Fiderlein’s concerns, he feels if a primary election is held it diverts the city’s resources and the candidates’ resources over a longer period of time. He explained in the past several municipal elections there has been an overall lack of interest in terms of the number of candidates filing for office and the number of people voting at the primary. He noted eliminating the primary would also be a first step towards potentially switching to the Ranked Choice Voting method in the future. Commissioner Beckstrand stated he shared many of Commissioner Fiderlein’s opinions and was very cautious about making amendments to the Charter. He explained he thought the open election that was held in 2015 for Mayor would have drawn more candidates and more interest from the public, and that did not happen. Commissioner Dyer stated he initially had similar concerns regarding elimination of the primary, but after seeing the historical data regarding the number of candidates filing for office and voter turn-out, he would support the proposed amendment because it may result in the public being more interested in serving in public office and more serious candidates filing for office. It was moved by Chair Carper, seconded by Commissioner Beckstrand, to move forward with the proposed amendments to Chapter 4, Sections 4.01, 4.03, 4.04, 4.05, 4.07, and 4.08 of the St. Louis Park Home Rule Charter and to direct the city clerk to prepare the recommendation of the Charter Commission for presentation to the City Council in the form of an ordinance amendment. The motion passed 8-1 (Commissioner Fiderlein opposed). Chair Carper asked for discussion and a recommendation regarding the proposed changes to Section 4.05 related to the number of signatures required on a nominating petition and the filing fee. He asked Ms. Kennedy to review the current candidate filing requirements. Ms. Kennedy stated candidates are required to pay a $20 filing fee and to submit a nominating petition with at least 15 signatures from registered electors qualified to vote for the office on the petition. She noted the changes suggested in the staff report were merely suggested as a starting point for further discussion. Commissioner Dyer suggested increasing the filing fee to $25 and increasing the number of signatures required to 35 or 40. He stated that increasing the number of signatures may result in more serious candidates filing for office. City Council Meeting of April 17, 2017 (Item No. 6a) Page 11 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements Commissioner Solmer suggested increasing the number of signatures to 100 and increasing the filing fee to $50. He noted his suggested filing fee was a compromise because he could make an argument for increasing it further. He stated candidates should have to get out into the community and put forth more effort to demonstrate they are truly invested in running for office, and it takes more effort to gather signatures. Chair Carper agreed with Commissioner Solmer’s comments and stated he did not think a $50 filing fee would be prohibitive to people filing for office. Commissioner Beckstrand agreed that it took more effort to gather signatures than to write a check. He cautioned the commission that raising costs will typically raise more ire from the general public. Commissioner Gothberg questioned if city staff had to verify the signatures on each petition filed. Ms. Kennedy stated her staff is responsible for verifying that the individuals signing each petition are registered voters qualified to vote for the office and that they have not signed more than one petition for that office. The commissioners discussed not increasing the signatures by so much that the verification task became overly burdensome on staff resources. Commissioner Jarvi suggested increasing the number of signatures to 50 and to leave the filing fee at $20. Commissioners Fiderlein, Dyer, and Gothberg concurred with Commissioner Jarvi’s suggestion. Chair Carper stated there seemed to be a consensus to focus on increasing the number of signatures rather than the changing the filing fee. Commissioner Carlson suggested that the recommendation to the council reflect that the Charter Commission chose to increase the number of signatures in lieu of fee increases to ensure that running for office did not become cost prohibitive for potential candidates. It was moved by Chair Carper, seconded by Commissioner Fiderlein, to move forward with an amendment to Chapter 4, Section 4.06 of the St. Louis Park Home Rule Charter to increase the number of signatures required on a nominating petition from fifteen (15) to fifty (50) and to direct the city clerk to prepare the recommendation of the Charter Commission for presentation to the City Council in the form of an ordinance amendment. The motion passed 9-0. Ms. Kennedy reviewed the Charter Commission’s recommendations and reiterated that the effective date of the amendment may be delayed until the next election cycle if the city attorney and city staff are not able to find a viable option to move forward within the statutory timeline requirements. Commissioner Carlson stated he would still support moving forward with the amendments even if they did not take effect for the 2017 election cycle. City Council Meeting of April 17, 2017 (Item No. 6a) Page 12 Title: Ordinance Related to Municipal Primary Elections and Candidate Filing Requirements The Charter Commission agreed with Commissioner Carlson, stating they would also support moving forward with their proposed recommendations to amend the Charter. 6. Future Meetings Ms. Kennedy stated the next meeting of the Charter Commission is scheduled for March 21, 2017 at 7:00 p.m. The meeting will be held in the Westwood Conference Room on the 3rd floor of City Hall. Commissioner Beckstrand informed the Commission that he would be traveling and unable to attend the meeting on March 21. He requested that his absence be excused. 7. Communications - None 8. Adjournment Chair Carper adjourned the meeting at 7:25 p.m. Respectfully submitted by: Melissa Kennedy, City Clerk Meeting: City Council Meeting Date: April 17, 2017 Public Hearing Agenda Item: 6b EXECUTIVE SUMMARY TITLE: PLACE Private Activity Revenue Bonds Financing (Housing) RECOMMENDED ACTION: The Mayor is asked to open the public hearing, take testimony and then close the hearing. The recommended action is then as follows: Motion to Adopt Resolution Authorizing the issuance and sale of multifamily housing revenue obligations for the benefit of VIA Affordable Living Limited Partnership: authorizing the execution and delivery of documents related thereto; adopting a housing program; and taking certain other actions. POLICY CONSIDERATION: Does the City Council wish to consider the issuance of tax exempt bonds to finance a portion of the proposed 299 housing units in the project in the approximate principal amount up to $27,185,503. SUMMARY: On January 23, 2017, the project received a multifamily housing bond allocation from the state in the amount of $27,185,503. This was less than the original request due to the oversubscription of housing bonds, but still sufficient for PLACE to accept the allocation. As part of the acceptance they have to issue bonds within one hundred twenty (120) days of the allocation award date. Since financing approvals necessary to issue the bonds will not be complete prior to the allocation expiration date. The borrower has requested the City issue a short-term multifamily revenue note, which will be a private placement and within one year of the issuance of the Note, bonds will be issued which will refund the note and finance the remaining costs of the housing project. The City Council is asked to conduct a public hearing, provide final approval for the issuance of the Note, and approve the documents related to the Note. This is all considered private activity bond financing. FINANCIAL OR BUDGET CONSIDERATION: The note/bonds will not impact the City’s debt capacity, does not constitute a general or moral obligation of the City, and will not be secured by the taxing powers of the City or any assets or property of the City. Per the City’s private activity revenue bond policy PLACE will pay an annual administration fee in the amount of 1/8th of 1% (0.125%) of the outstanding principal of the bonds. The Admin fee is currently estimated at $781,375 over the life of the bonds. The Admin fee goes to the Housing Rehab Fund and has a present value of $452,353. SUPPORTING DOCUMENTS: Discussion Kennedy & Graven Attorney Letter Resolution Housing Program Prepared by: Tim Simon, Chief Financial Officer Reviewed by: Nancy Deno, Deputy City Manager/HR Director Kevin Locke CD Director Michele Schnitker, Deputy CD Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 6b) Page 2 Title: PLACE Private Activity Revenue Bonds Financing (Housing) DISCUSSION BACKGROUND: PLACE, a Minnesota nonprofit corporation, has proposed the acquisition, construction, and equipping of a mixed-use, mixed-income, transit-oriented development on property located at 5725, 5925, and 5815 Highway 7, 3565 and 3575 Wooddale Avenue, 5814 and 5816 36th Street, 3520 Yosemite Avenue, and the western portion of 3548 Xenwood Avenue in the City. The development will include 299 apartments (200 affordable and 99 market rate), space for local businesses, a hotel, an e-generation facility, and live/work space designed for creatives. On December 19, 2016, the City Council adopted a resolution authorizing PLACE to seek $55 million in multifamily housing bond allocation from the State. On January 23, 2017, the project received an allocation in the amount of $27,185,503 which is less than anticipated due to the oversubscription of housing bonds, but still sufficient for the project to obtain low-income housing tax credits. PLACE must close on the bonds by May 22, 2017. The term of these bonds is anticipated to be 35 years at 5% interest. Allianz Life Insurance Company of North America will purchase the project’s tax credits and the purchase price will provide equity for the housing project. Since financing approvals necessary to issue the bonds will not be complete prior to the allocation expiration date, the borrower has requested the City issue a temporary multifamily revenue note, which will be a private placement. Once the borrower has financing commitments for the remaining portion of the housing project, the borrower will ask the City to issue permanent financing in the form of tax-exempt bonds to refund the temporary note. PLACE also intends to request additional conduit bond assistance from the City or another public entity in the future to finance the remaining portions of the project which are financeable with tax-exempt bonds. NEXT STEPS: The temporary note will close before May 22. In addition, the borrower will continue to work toward obtaining planning and zoning approvals and approval of TIF documentation. Council will be required to approve the final bonds that will be used to refund the note. City Council Meeting of April 17, 2017 (Item No. 6b) Page 3 Title: PLACE Private Activity Revenue Bonds Financing (Housing) April 11, 2017 Tim Simon, Chief Financial Officer City of St. Louis Park 5005 Minnetonka Boulevard St. Louis Park, MN 55416-2216 Re: Resolution approving a multifamily housing project to be financed with conduit revenue obligations proposed to be issued by the City of St. Louis Park Dear Tim, As you know, PLACE, a Minnesota nonprofit corporation and an organization described in Section 501(c)(3) of the Internal Revenue Code of 1986, as amended (the “Code”), has proposed the acquisition, construction, and equipping of a mixed-use, mixed-income, transit-oriented development on property located at 5725, 5925, and 5815 Highway 7, 3565 and 3575 Wooddale Avenue, 5814 and 5816 36th Street, 3520 Yosemite Avenue, and the western portion of 3548 Xenwood Avenue in the City of St. Louis Park (the “City”). The development is expected to include approximately 299 apartments (200 affordable and 99 market rate), space for local businesses, a hotel, an e-generation facility, and live/work space designed for creatives (collectively, the “Project”). Via Affordable Living Limited Partnership, whose general partner is PLACE E-Generation One LLC, a Delaware limited liability nonprofit company registered to do business in Minnesota, Via Apartments, LLC and/or another affiliate of PLACE (collectively, the “Borrower”), have requested the assistance of the City in financing all or a portion of the costs of the acquisition, construction, and equipping of the 299 affordable and market -rate apartments within the Project (the “Housing Project”) through the issuance of conduit revenue bonds in a maximum principal amount of $27,185,503. The conduit revenue bonds (the “Bonds”) will be issued under Minnesota Statutes, Chapter 462C, as amended (the “Act”). One of the requirements set forth in Section 462C.03, subdivision 1a of the Act is that the City Council approve a housing program (the “Housing Program”) prior to issuing the Bonds. Section 146 of the Code requires that the Bonds receive an allocation of bonding authority of the State of Minnesota. On January 23, 2017, the City received allocation for the Housing Project from Minnesota Management & Budget in the amount of $27,185,503, in accordance with the terms of Minnesota Statutes, Chapter 474A, as amended (the “Allocation Act”). Pursuant to the Allocation Act, the Bonds must be issued within one hundred twenty (120) days of the date of allocation (the “Award Expiration Date”). The Bonds are expected to be secured by a mortgage, tax credit investor contributions, and/or other security. However, the financing approvals necessary to issue the Bonds will not be complete by the Award Expiration Date. In order to provide short-term financing for the Housing Project and avoid the expiration of the bond allocation obtained from the State of Minnesota, the Borrower is asking the City to issue a short-term conduit revenue obligation (the “Note”) in the maximum principal amount of $27,185,503, which will be privately placed with a commercial lender to be selected by the Borrower (the “Purchaser”). The City Council Meeting of April 17, 2017 (Item No. 6b) Page 4 Title: PLACE Private Activity Revenue Bonds Financing (Housing) enclosed resolution authorizes the issuance of the Note and also authorizes the execution of the Note, a Loan Agreement, a Pledge Agreement, and a Regulatory Agreement. The enclosed resolution also approves the Housing Program pursuant to the requirements of the Act. Once the Borrower is able to obtain the necessary financing approvals, the Borrower will return to the City Council to request that the City issue the Bonds as permanent financing for the Housing Project. The proceeds of the Bonds will be used to refund the Note and finance the remaining costs of the Housing Project. The Note will be secured solely by the revenues derived from the Loan Agreement to be executed by the Borrower and from other security provided by the Borrower, which may include one or more guaranties. The Note will not constitute a general or moral obligation of the City and will not be secured by or payable from any property or assets of the City (other than the interests of the City in the Loan Agreement) and will not be secured by any taxing power of the City. The Note will not be subject to any debt limitation imposed on the City, and the issuance of the Note will not have any adverse impact on the credit rating of the City, even in the event that the Borrower encounters financial difficulties with respect to the Housing Project. The Note will constitute a “private activity bond” within the meaning of Section 141(a) of the Code but will be an “exempt facility bond” the net proceeds of which are to be used to provide a “qualified residential rental project” within the meaning of Sections 142(a)(7) and 143(d) of the Code and will not affect the City’s ability to designate up to $10,000,000 in tax-exempt bonds as “qualified tax-exempt obligations” (or “bank-qualified bonds”) for calendar year 2017. The Borrower will agree to pay the out-of-pocket expenses of the City with respect to this transaction as well as the City’s administrative fee. I will attend the City Council meeting on April 17, 2017 and can answer any questions that may arise during the meeting. Please contact me with any questions you may have prior to the City Council meeting. Sincerely, Julie A. Eddington City Council Meeting of April 17, 2017 (Item No. 6b) Page 5 Title: PLACE Private Activity Revenue Bonds Financing (Housing) RESOLUTION NO. 17-_____ RESOLUTION AUTHORIZING THE ISSUANCE AND SALE OF MULTIFAMILY HOUSING REVENUE OBLIGATIONS FOR THE BENEFIT OF VIA AFFORDABLE LIVING LIMITED PARTNERSHIP; AUTHORIZING THE EXECUTION AND DELIVERY OF DOCUMENTS RELATED THERETO; ADOPTING A HOUSING PROGRAM; AND TAKING CERTAIN OTHER ACTIONS BE IT RESOLVED by the City Council (the “City Council”) of the City of St. Louis Park, Minnesota (the “City”), as follows: Section 1. Recitals. 1.01. The City is a home rule city duly organized and existing under its Charter and the Constitution and laws of the State of Minnesota. 1.02. Pursuant to Minnesota Statutes, Chapter 462C, as amended (the “Act”), the City is authorized to carry out the public purposes described in the Act by providing for the issuance of revenue obligations to provide funds to finance multifamily housing developments. 1.03. PLACE, a Minnesota nonprofit corporation and an organization described in Section 501(c)(3) of the Internal Revenue Code of 1986, as amended (the “Code”), has proposed the acquisition, construction, and equipping of a mixed-use, mixed-income, transit-oriented development on property located at 5725, 5925, and 5815 Highway 7, 3565 and 3575 Wooddale Avenue, 5814 and 5816 36th Street, 3520 Yosemite Avenue, and the western portion of 3548 Xenwood Avenue in the City. The proposed development includes approximately 299 apartments (200 affordable and 99 market rate), space for local businesses, a hotel, an e- generation facility, and live/work space designed for creatives (collectively, the “Project”). 1.04. Via Affordable Living Limited Partnership, whose general partner is PLACE E-Generation One LLC, a Delaware limited liability nonprofit company registered to do business in Minnesota, Via Apartments, LLC and/or another affiliate of PLACE (collectively, the “Borrower”) are requesting that the City issue multifamily housing revenue bonds as tax-exempt obligations (the “Bonds”) pursuant to the Act, in the maximum aggregate principal amount of $27,185,503, for the benefit of the Borrower, in order to (i) finance all or a portion of the costs of the acquisition, construction, and equipping of the approximately 299 apartments to be included in the Project (the “Housing Project”); (ii) finance capitalized interest during the construction of the Housing Project, if needed; (iii) fund required reserves, if any; and (iv) pay costs of issuance of the Bonds. The Housing Project will be owned and operated by the Borrower. 1.05. As a condition to the issuance of the Bonds, the City must adopt a housing program providing the information required by Section 462C.03, subdivision 1a of the Act (the “Housing Program”). The Housing Program was prepared and submitted to Metropolitan Council for its review and comment. 1.06. Under Section 147(f) of the Code, prior to the issuance of the Bonds, the City Council must conduct a public hearing after one publication of notice in a newspaper circulating generally in the City at least fourteen (14) days before the hearing. Under Section 462C.04, subdivision 2 of the Act, a public hearing must be held on the housing program after one City Council Meeting of April 17, 2017 (Item No. 6b) Page 6 Title: PLACE Private Activity Revenue Bonds Financing (Housing) publication of notice in a newspaper circulating generally in the City at least fifteen (15) days before the hearing. 1.07. On the date hereof, the City Council conducted a public hearing on the Housing Program and the issuance of revenue obligations to finance the Housing Project and pay other costs. Notice of the hearing (the “Public Notice”) was published as required by Section 462C.04, subdivision 2 of the Act and Section 147(f) of the Code. The Public Notice was published in the Sun Sailor, the official newspaper of and a newspaper circulating generally in the City, on March 30, 2017, a date at least fifteen (15) days before a meeting of the City Council on the date hereof. At the public hearing, a reasonable opportunity was provided for interested individuals to express their views, both orally and in writing, on the Housing Program and the proposed issuance of the revenue obligations. 1.08. On January 23, 2017, the City received Certificate of Allocation No. 299 from Minnesota Management & Budget allocating bonding authority to the City in the amount of $27,185,503, pursuant to Minnesota Statutes, Chapter 474A (the “Allocation Act”). In accordance with Allocation Act, the Bonds must be issued within one hundred twenty (120) days of the allocation award date (the “Allocation Expiration Date”). 1.09. The Bonds are expected to be secured by a mortgage, tax credit investor contributions, and/or other security. The financing approvals necessary to issue the Bonds will not be complete prior to the Allocation Expiration Date. 1.10. In order to provide short-term financing for the Housing Project, the Borrower has requested that the City issue its Multifamily Housing Revenue Note (PLACE St. Louis Park Multifamily Housing Project), Series 2017 (the “Note”), in one or more series, in the maximum principal amount of $27,185,503. The Borrower has further proposed that a commercial lender selected by the Borrower (the “Purchaser”) purchase the Note. 1.11. The Note is expected to be issued on a short-term basis. The Bonds are proposed to be issued as permanent financing for the Housing Project within one year of the issuance of the Note, at which time proceeds of the Bonds will refund the Note and finance the remaining costs of the Housing Project. 1.12. With respect to the Note, there have been presented before the City Council (i) a form of Loan Agreement (the “Loan Agreement”) proposed to be entered into between the City and the Borrower, pursuant to which the City will loan the proceeds of the Note to the Borrower; (ii) a form of Pledge Agreement (the “Pledge Agreement”) proposed to be entered into between the City and the Purchaser, pursuant to which the City will assign the repayments to be made under the Loan Agreement to the Purchaser; (iii) a form of the Note; (iv) a form of Regulatory Agreement (the “Regulatory Agreement”) proposed to be entered into between the City, the Borrower, and the Purchaser to ensure compliance with certain rental and occupancy restrictions imposed by the Act and Section 142(d) of the Code and to ensure compliance with certain restrictions imposed by the City; and (v) a form of Disbursing Agreement (the “Disbursing Agreement”) proposed to be entered into between the Borrower and the Purchaser. Section 2. The Housing Program. The Housing Program, in the form substantially on file with the City, is hereby approved. City Council Meeting of April 17, 2017 (Item No. 6b) Page 7 Title: PLACE Private Activity Revenue Bonds Financing (Housing) Section 3. The Note. 3.01. The Borrower has requested that the City issue, sell, and deliver the Note, in one or more series, in the maximum principal amount of $27,185,503, to the Purchaser for the purposes of financing the Housing Project and paying costs of issuance of the Note. 3.02. The proceeds derived from the sale of the Note will be loaned by the City to the Borrower pursuant to the terms of the Loan Agreement. 3.03. The Note and the interest on the Note (i) shall be payable solely from the revenues pledged therefor under the Loan Agreement and additional sources of revenue provided by or on behalf of the Borrower; (ii) shall not constitute a debt of the City within the meaning of any constitutional or statutory limitation; (iii) shall not constitute nor give rise to a pecuniary liability of the City or a charge against its general credit or taxing powers; (iv) shall not constitute a charge, lien, or encumbrance, legal or equitable, upon any property of the City other than the City’s interest in the Loan Agreement; and (v) shall not constitute a general or moral obligation of the City. 3.04. The loan repayments to be made by the Borrower under the Loan Agreement will be fixed so as to produce revenue sufficient to pay the principal of, premium, if any, and interest on the Note when due. Such loan repayments will be assigned to the Purchaser under the terms of the Pledge Agreement. 3.05. The City acknowledges, finds, determines, and declares that the issuance of the Note is authorized by the Act and is consistent with the purposes of the Act and that the issuance of the Note, and the other actions of the City under the Loan Agreement, the Pledge Agreement, and this resolution constitute a public purpose and are in the interests of the City. In authorizing the issuance of the Note for the financing of the Housing Project and the related costs, the City’s purpose is and the effect thereof will be to promote the public welfare of the City and its residents by providing multifamily housing developments for low or moderate income residents of the City and otherwise furthering the purposes and policies of the Act. 3.06. For the purposes set forth above, there is hereby authorized the issuance, sale, and delivery of the Note in the maximum aggregate principal of $27,185,503. The Note shall bear interest at the rate or rates, shall be designated, shall be numbered, shall be dated, shall mature, shall be in the aggregate principal amount, shall be subject to redemption prior to maturity, shall be in such form, and shall have such other terms, details, and provisions as are prescribed in the Note, substantially in the form now on file with the City, with the amendments referenced herein. The City hereby authorizes all or a portion of the Note to be issued as a “tax-exempt bond,” the interest on which is not includable in gross income for federal and State of Minnesota income tax purposes. All of the provisions of the Note, when executed as authorized herein, shall be deemed to be a part of this resolution as fully and to the same extent as if incorporated verbatim herein and shall be in full force and effect from the date of execution and delivery thereof. The Note shall be substantially in the form now on file with the City, which form is hereby approved, with such necessary and appropriate variations, omissions, and insertions (including changes to the aggregate principal amount of the Note, the stated maturity of the Note, the interest rate or rates on the Note and the terms of redemption of the Note) as the Mayor and the City Manager, in their discretion, shall determine. The execution of the Note with the manual or facsimile City Council Meeting of April 17, 2017 (Item No. 6b) Page 8 Title: PLACE Private Activity Revenue Bonds Financing (Housing) signatures of the Mayor and the City Manager and the delivery of the Note by the City shall be conclusive evidence of such determination. 3.07. The Note shall be a special, limited obligation of the City payable solely from the revenues provided by the Borrower pursuant to the Loan Agreement and other funds pledged to the payment of the Note. The City Council hereby authorizes and directs the Mayor and the City Manager to execute the Note in accordance with the terms thereof. 3.08. The Mayor and the City Manager are hereby authorized and directed to execute and deliver the Loan Agreement, the Pledge Agreement, and the Regulatory Agreement. All of the provisions of the Loan Agreement, the Pledge Agreement, and the Regulatory Agreement, when executed and delivered as authorized herein, shall be deemed to be a part of this resolution as fully and to the same extent as if incorporated verbatim herein and shall be in full force and effect from the date of execution and delivery thereof. The Loan Agreement, the Pledge Agreement, and the Regulatory Agreement shall be substantially in the forms on file with the City which are hereby approved, with such omissions and insertions as do not materially change the substance thereof, and as the Mayor and the City Manager, in their discretion, shall determine, and the execution thereof by the Mayor and the City Manager shall be conclusive evidence of such determinations. 3.09. The Mayor, the City Manager, and the Chief Financial Officer of the City are hereby authorized to execute and deliver, on behalf of the City, such other documents and certificates as are necessary or appropriate in connection with the issuance, sale, and delivery of the Note, including various certificates of the City, an Information Return for Tax-Exempt Private Activity Bond Issues, Form 8038 (Rev. April 2011), an endorsement of the City to the tax certificate of the Borrower, and similar documents, and all other documents and certificates as shall be necessary and appropriate in connection with the issuance, sale, and delivery of the Note. The City hereby authorizes Kennedy & Graven, Chartered, as bond counsel (“Bond Counsel”), to prepare, execute, and deliver its approving legal opinion with respect to the Note. 3.10. The Chief Financial Officer of the City is appointed note registrar and paying agent for the Note. 3.11. The City Council authorizes the execution and delivery of the Disbursing Agreement by the Borrower and the Purchaser and authorizes the disbursement of the proceeds of the Note pursuant to the Disbursing Agreement or any other agreement providing for the disbursement of proceeds of the Note. The Purchaser is authorized to accept the Pledge Agreement in order to secure payment of the Note and is hereby authorized to take all actions necessary or appropriate under the terms of the Pledge Agreement to ensure timely payment of the principal of, premium, if any, and interest on the Note. 3.12. The City hereby authorizes the Borrower to provide such security for payment of its obligations under the Loan Agreement and for payment of the Note, including but not limited to one or more guaranties or any other security agreed upon by the Borrower and the Purchaser, and the City hereby approves the execution and delivery of such security by the parties thereto. Section 4. Additional Findings and Certifications. 4.01. Except as otherwise provided in this resolution, all rights, powers, and privileges conferred and duties and liabilities imposed upon the City or the City Council by the provisions City Council Meeting of April 17, 2017 (Item No. 6b) Page 9 Title: PLACE Private Activity Revenue Bonds Financing (Housing) of this resolution or of the aforementioned documents shall be exercised or performed by the City or by such members of the City Council, or such officers, board, body or agency thereof as may be required or authorized by law to exercise such powers and to perform such duties. No covenant, stipulation, obligation or agreement herein contained or contained in the aforementioned documents shall be deemed to be a covenant, stipulation, obligation or agreement of any member of the City Council, or any officer, agent or employee of the City in that person’s individual capacity, and neither the City Council nor any officer or employee executing the Note shall be personally liable on the Note or be subject to any personal liability or accountability by reason of the issuance thereof. No provision, covenant or agreement contained in the aforementioned documents, the Note, or in any other document relating to the Note, and no obligation therein or herein imposed upon the City or the breach thereof, shall constitute or give rise to a general or moral obligation of the City or any pecuniary liability of the City or any charge upon its general credit or taxing powers. In making the agreements, provisions, covenants, and representations set forth in such documents, the City has not obligated itself to pay or remit any funds or revenues, other than funds and revenues derived from the Loan Agreement which are to be applied to the payment of the Note, as provided therein. 4.02. Except as herein otherwise expressly provided, nothing in this resolution or in the aforementioned documents expressed or implied is intended or shall be construed to confer upon any person or firm or corporation, other than the City, any holder of the Note issued under the provisions of this resolution, any right, remedy or claim, legal or equitable, under and by reason of this resolution or any provisions hereof, this resolution, the aforementioned documents, and all of their provisions being intended to be and being for the sole and exclusive benefit of the City, and any holder from time to time of the Note issued under the provisions of this resolution. 4.03. In case any one or more of the provisions of this resolution, other than the provisions contained in the first sentence of Section 3.07 hereof, or of the aforementioned documents, or of the Note issued hereunder shall for any reason be held to be illegal or invalid, such illegality or invalidity shall not affect any other provision of this resolution, or of the aforementioned documents, or of the Note, but this resolution, the aforementioned documents, and the Note shall be construed and endorsed as if such illegal or invalid provisions had not been contained therein. 4.04. The Note, when executed and delivered, shall contain a recital that it is issued pursuant to the Act, and such recital shall be conclusive evidence of the validity of the Note and the regularity of the issuance thereof, and that all acts, conditions, and things required by the laws of the State of Minnesota relating to the adoption of this resolution, to the issuance of the Note, and to the execution of the aforementioned documents to happen, exist, and be performed precedent to the execution of the aforementioned documents have happened, exist, and have been performed as so required by law. 4.05. The officers of the City, Bond Counsel, other attorneys, engineers, and other agents or employees of the City are hereby authorized to do all acts and things required of them by or in connection with this resolution, the aforementioned documents, and the Note, for the full, punctual, and complete performance of all the terms, covenants, and agreements contained in the Note, the aforementioned documents, and this resolution. If for any reason the Mayor or the City Manager is unable to execute and deliver the documents referred to in this resolution, City Council Meeting of April 17, 2017 (Item No. 6b) Page 10 Title: PLACE Private Activity Revenue Bonds Financing (Housing) such documents may be executed by any member of the City Council or any officer of the City delegated the duties of the Mayor or the City Manager with the same force and effect as if such documents were executed and delivered by the Mayor or the City Manager. 4.06. The Borrower shall pay the administrative fee of the City as set forth in the Loan Agreement. The Borrower will also pay, or, upon demand, reimburse the City for payment of, any and all costs incurred by the City in connection with the Housing Project and the issuance of the Note, whether or not the Note is issued, including any costs for attorneys’ fees. Section 5. Effective Date. This resolution shall be in full force and effect from and after its approval. The approvals contained in the resolution are effective for one year after the date hereof. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk City Council Meeting of April 17, 2017 (Item No. 6b) Page 11 Title: PLACE Private Activity Revenue Bonds Financing (Housing) CITY OF ST. LOUIS PARK, MINNESOTA HOUSING PROGRAM FOR A MULTIFAMILY HOUSING DEVELOPMENT Pursuant to Minnesota Statutes, Chapter 462C, as amended (the “Housing Act”), the City of St. Louis Park, Minnesota (the “City”) is authorized to develop and administer programs to finance the acquisition, construction, and equipping of multifamily housing developments under the circumstances and within the limitations set forth in the Housing Act. Section 462C.07 of the Housing Act provides that such programs for multifamily housing developments may be financed by revenue bonds issued by the City. The City has received a proposal that it approve a program providing for the acquisition, construction, and equipping of approximately 299 affordable and market-rate apartments (the “Housing Project”) to be constructed as part of a larger mixed-use, mixed-income, transit- oriented development on property located at 5725, 5925, and 5815 Highway 7, 3565 and 3575 Wooddale Avenue, 5814 and 5816 36th Street, 3520 Yosemite Avenue, and the western portion of 3548 Xenwood Avenue in the City. The acquisition, construction, and equipping of the Housing Project is to be funded in part through the issuance by the City of one or more series of tax-exempt revenue obligations (the “Bonds”) in the aggregate principal amount not to exceed $27,185,503, the proceeds of which will be loaned to Via Affordable Living Limited Partnership, whose general partner is PLACE E-Generation One LLC, a Delaware limited liability nonprofit company registered to do business in Minnesota, Via Apartments, LLC and/or another affiliate of PLACE, a Minnesota nonprofit corporation and an organization described in Section 501(c)(3) of the Internal Revenue Code of 1986, as amended (collectively, the “Borrower”). It is expected that a portion of the apartments of the Housing Project will be subject to occupancy limits imposed by federal income tax law and regulations such that only persons and families within designated income limits will be permitted to occupy such apartments. The City, in establishing this multifamily housing program (the “Program”), has considered the information contained in the City’s comprehensive plan. The Housing Project will be constructed in accordance with the requirements of Section 462C.05, subdivisions 1 and 2 of the Housing Act. Section A. Definitions. The following terms used in this Program shall have the following meanings, respectively: “Apartments” shall mean any one of the apartments financed with the Bonds, each located in the Housing Project, occupied by one person or family, and containing complete living facilities. “Bonds” shall mean the revenue bonds to be issued by the City to finance the Housing Project. “Borrower” shall mean Via Affordable Living Limited Partnership, whose general partner is PLACE E-Generation One LLC, a Delaware limited liability nonprofit company registered to do business in Minnesota, Via Apartments, LLC and/or another affiliate of PLACE, a Minnesota nonprofit corporation and an organization described in Section 501(c)(3) of the Internal Revenue Code of 1986, as amended. City Council Meeting of April 17, 2017 (Item No. 6b) Page 12 Title: PLACE Private Activity Revenue Bonds Financing (Housing) “City” shall mean the City of St. Louis Park, Minnesota. “Housing Act” shall mean Minnesota Statutes, Chapter 462C, as currently in effect and as the same may be from time to time amended. “Housing Project” shall mean the approximately 299 affordable and market-rate apartments within the development to be located at 5725, 5925, and 5815 Highway 7, 3565 and 3575 Wooddale Avenue, 5814 and 5816 36th Street, 3520 Yosemite Avenue, and the western portion of 3548 Xenwood Avenue in the City, to be acquired, constructed, and equipped by the Borrower. “Land” shall mean the real property upon which the Housing Project is situated. “Program” shall mean this housing program for the financing of the Housing Project pursuant to the Housing Act. Section B. Program for Financing the Housing Project. It is proposed that the City establish this Program to provide financing for the acquisition, construction, and equipping of the Housing Project at a cost and upon such other terms and conditions as are set forth herein and as may be agreed upon in writing between the City, the initial purchaser(s) of the Bonds, and the Borrower. The City expects to issue the Bonds in one or more series as soon as the terms of the Bonds have been agreed upon by the City, the Borrower, and the initial purchaser(s) of the Bonds. The proceeds of the Bonds will be loaned to the Borrower to finance the acquisition, construction, and equipping of the Housing Project, to fund required reserves, if any, to finance interest on the Bonds during construction of the Housing Project, if needed, and to pay the costs of issuing the Bonds. A trustee may be appointed by the City to provide for the payment of the principal of and interest on a portion of the Bonds. It is anticipated that all series of Bonds will have a maturity of approximately forty (40) years or less. It is expected that the Bonds will bear interest consistent with the market at the time of issuance. The City will hire no additional staff for the administration of the Program. Insofar as the City will be contracting with underwriters, legal counsel, bond counsel, the trustee, and others, all of whom will be reimbursed from bond proceeds and revenues generated by the Program, no administrative costs will be paid from the City’s budget with respect to this Program. The Bonds will not be general obligations of the City, but will be issued as conduit revenue obligations to be paid only from loan repayments by the Borrower and revenues generated by the property pledged to the payment thereof, which may include additional security such as additional collateral, insurance or a letter of credit. Section C. Standards and Requirements Relating to the Financing of the Housing Project Pursuant to the Program. The following standards and requirements shall apply with respect to the operation of the Housing Project by the Borrower pursuant to this Program: (1) Substantially all of the proceeds of the sale of the Bonds will be applied to the acquisition, construction, and equipping of the Housing Project, the payment of the costs of issuing the Bonds, the payment of interest on the Bonds during the construction of the Housing Project, if needed, and the funding of required reserves, if any. The proceeds of the Bonds will be made available to the Borrower pursuant to the terms of one or more loan agreements (or other revenue agreements) which will include certain City Council Meeting of April 17, 2017 (Item No. 6b) Page 13 Title: PLACE Private Activity Revenue Bonds Financing (Housing) covenants to be made by the Borrower to the City regarding the use of proceeds and the character and use of the Housing Project. (2) The Housing Project qualifies as a “multifamily housing development” within the meaning of the Housing Act, since it is comprised of an apartment facility, the Apartments of which are to be rented to persons or families for use as residences. (3) The Borrower, and any subsequent owner of the Housing Project, will not arbitrarily reject an application from a proposed tenant because of race, color, creed, religion, national origin, sex, marital status, or status with regard to public assistance or disability. (4) Either (i) at least twenty percent (20%) of the Apartments will be held for occupancy by families or individuals with gross income not in excess of fifty percent (50%) of median family income, adjusted for family size; or (ii) at least forty percent (40%) of the Apartments will be held for occupancy by families or individuals with gross income not in excess of sixty percent (60%) of median family income, adjusted for family size. This set aside will satisfy the low-income occupancy requirements of Section 462C.05, subdivision 2 of the Housing Act. Section D. Evidence of Compliance. The City may require from the Borrower at or before the issuance of the Bonds evidence satisfactory to the City of compliance with the standards and requirements for the financing established by the City, as set forth herein; and in connection therewith, the City or its representatives may inspect the relevant books and records of the Borrower in order to confirm such ability, intention and compliance. In addition, the City may periodically require certification from either the Borrower or such other person deemed necessary concerning compliance with various aspects of this Program. Section E. Issuance of Bonds. To finance the Housing Project, the City will by resolution authorize, issue and sell the Bonds, in one or more series of tax-exempt obligations, in the aggregate principal amount not to exceed $27,185,503. The Bonds will be issued pursuant to Section 462C.07, subdivision 1 of the Housing Act, and will be payable primarily from the revenues of the Housing Project. If the costs of the Housing Project, including capitalized interest, if any, costs of issuance of the Bonds, and any required reserve funds exceed the principal amount of the Bonds, the Borrower will contribute to the Housing Project the difference between the total costs of the Housing Project and the principal amount of the Bonds available to finance the Housing Project. The costs of the Housing Project may change between the date of preparation of this Program and the date of issuance of the Bonds. The Bonds are expected to be issued in spring 2017. Section F. Severability. The provisions of this Program are severable and if any of its provisions, sentences, clauses or paragraphs shall be held unconstitutional, contrary to statute, exceeding the authority of the City or otherwise illegal or inoperative by any court of competent jurisdiction, the decision of such court shall not affect or impair any of the remaining provisions. Section G. Amendment. While Bonds authorized hereby are outstanding, the City shall not amend this Program to the detriment of the holders of such Bonds. Section H. State Ceiling. City Council Meeting of April 17, 2017 (Item No. 6b) Page 14 Title: PLACE Private Activity Revenue Bonds Financing (Housing) (1) An application for an allocation of a portion of the annual volume cap for private activity bonds to be issued to provide “qualified residential rental projects,” within the meaning of Sections 142(a)(7) and 142(d) of the Internal Revenue Code of 1986, as amended (the “Code”), has been made to the office of Minnesota Management & Budget, pursuant to Section 146 of the Code and Minnesota Statutes, Chapter 474A, as amended (the “Allocation Act”). (2) Pursuant to the terms and requirements of the Allocation Act: (i) the Housing Project will meet the requirements of Section 142(d) of the Code regarding the incomes of the occupants of the Housing Project; and (ii) the maximum rent for at least twenty percent (20%) of the Apartments will not exceed the area fair market rent or exception fair market rents for existing housing, if applicable, as established by the United States Department of Housing and Urban Development. (3) Prior to the issuance of the Bonds, the Borrower will enter into an agreement with the City that specifies the maximum rental rates of the rent-restricted Apartments and the income levels of the residents of the Housing Project occupying the income-restricted Apartments (the “Regulatory Agreement”). Such rental rates and income levels must be within the limitations established in accordance with the preceding paragraph (2). The Borrower will be required to annually certify to the City over the term of the agreement that the rental rates for the rent-restricted Apartments are within the limitations under the preceding paragraph (2). The City may request individual certification of the income of residents of the income-restricted Apartments. The office of Minnesota Management & Budget may request from the City a copy of the annual certification prepared by the Borrower. The office of Minnesota Management & Budget may require the City to request individual certification of all residents of the income-restricted Apartments of the Housing Project. (4) The City will monitor Housing Project compliance with the rental rate and income level requirements established under the preceding paragraph (2). The City may issue an order of noncompliance if the Housing Project is found by the City to be out of compliance with the rental-rate or income-level requirements established under the preceding paragraph (2). The Borrower shall pay a penalty to the City equal to one-half of one percent (0.5%) of the total amount of the tax-exempt Bonds issued under the Housing Act for the Housing Project if the City issues an order of noncompliance. For each additional year the Housing Project is out of compliance, the annual penalty must be increased by one-half of one percent (0.5%) of the principal amount of tax-exempt Bonds issued under the Housing Act for the Housing Project. The City may waive insubstantial violations. (5) The City will enter into the Regulatory Agreement with the Borrower with a term of at least fifteen (15) years in order to ensure that the Housing Project satisfies the requirements of this Program, Section 142(d) of the Code, the Housing Act, and the Allocation Act. Meeting: City Council Meeting Date: April 17, 2017 Action Agenda Item: 8a EXECUTIVE SUMMARY TITLE: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final Planned Unit Development RECOMMENDED ACTION: •Motion to Adopt Resolution approving the Comprehensive Plan Land Use Map Amendment (requires 5 affirmative votes); and •Motion to approve First Reading of Ordinance adding Section 36-268-PUD 9 to the Zoning Code and amending the Zoning Map from IG-General Industrial and MX-Mixed Use to PUD 9 for the property located at the southeast quadrant of highway 7 and Wooddale Avenue and the northeast corner of West 36th Street and Wooddale Avenue, and set the second reading for May 1, 2017 (requires 4 affirmative votes). POLICY CONSIDERATION: Does the City Council support the proposed Comprehensive Plan Amendment and PUD to allow for the PLACE redevelopment? SUMMARY: PLACE (Projects Linking Art, Community & Environment), a Minneapolis 501(c)(3) nonprofit developer, proposes to acquire four properties at the southeast quadrant of Highway 7 and Wooddale Ave, and five properties at the northeast corner of W 36th Street and Wooddale Ave., raze two structurally substandard buildings and replace them with a landmark mixed-use, mixed income, transit oriented, and environmentally sustainable development. Project components include: two apartment buildings with a total of 299 residential units (200 affordable and 99 market rate), a 110-room hotel, a 10,000 SF e-generation/co-generation/greenhouse facility, approximately 15,400 SF of ground floor commercial/retail space, and a one acre “urban forest”. The PUD is needed to rezone the property from I-G General Industrial and MX Mixed Use to allow for a mixed-use building. The PUD also provides flexibility on height, density, and parking. FINANCIAL OR BUDGET CONSIDERATION: There are some sizable extraordinary costs associated with the proposed redevelopment site and building that prevent the project from being financially feasible. Consequently, the developer has submitted an application for tax increment financing to defray a portion of these expenses. VISION CONSIDERATION: St. Louis park is committed to providing a well-maintained and diverse housing stock. SUPPORTING DOCUMENTS: Discussion, Aerial Photo, Resolution & Summary, PUD Ordinance Draft, Planning Commission Minutes, Development Plans, Sustainability Proposals, Traffic Study, Parking Analysis , Mobility Plan, Solar Study Prepared by: Jennifer Monson, Planner Reviewed by: Sean Walther, Planning and Zoning Supervisor Michele Schnitker, Deputy CD Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 8a) Page 2 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD DISCUSSION DEVELOPMENT SUMMARY: PLACE E-generation One, LLC (PLACE), a 501(c)(3), proposes to redevelop property north and south of the future SWLRT Wooddale Avenue Station into a mixed-income, mixed-use, multigenerational, environmentally sustainable, transit-oriented development with live/work units for creatives. The development includes: •299 apartments (200 affordable, 99 market-rate), including 99 mixed-income live/work •110-room Fairfield by Marriott hotel •Café, coffee house, bike shop, and five microbusinesses •PLACE’s E-Generation facility on the northern site, which uses PLACE’s patent-pending portfolio of renewable energy systems to convert locally-sourced organic waste into energy for the project and a soil amendment byproduct that will be used in the onsite greenhouse. •0.88 acres of urban forest, for public access to nature, stormwater management, and habitat •29,500 square feet of green roof for additional stormwater management and habitat •Buildings, site and program designed to support a multigenerational community. •Mobility Plan with car/bike sharing, shuttle, and car-free living incentives •Surface and underground parking on the northern site as well as underground parking south of the rail, which leaves ground space for a “woonerf/place-making plaza” adjacent to the LRT station to provide pedestrian-oriented multiuse space The development will generate 100 full time equivalent, living wage jobs, be home to at least 90 car-free households, and will be LEED, Leadership in Energy and Environmental Design, certified buildings across the site. In addition to LEED, the project team is maximizing the sustainability potential for design, cleanup, construction and operation to minimize the use of energy, water, materials and other resources. City Council Meeting of April 17, 2017 (Item No. 8a) Page 3 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD The program of mixed-income housing, live/work, local businesses, E-Generation, Mobility Plan, and LEED is based on PLACE’s experience developing healthy, mixed-income communities, and its mission to link arts, community and environment. The proposed buildings range in height from one-story for the e-generation building to a five-story mixed-use building on the northeast site, and two six-story buildings on the south site. REQUEST: The applicant requests that the city: 1.Amend the Comprehensive Plan Land Use Map for these parcels from Office, Business Park, Railroad, and Right-of-Way to Mixed-Use. 2. Approve a preliminary and final plat to combine parcels for development. 3.Amend the zoning map and zoning ordinance to rezone the subject properties from I-G General Industrial and C-2 General Commercial to Planned Unit Development. SITE INFORMATION: The proposed redevelopment site is located in the Elmwood neighborhood at the southeast quadrant of Highway 7 and Wooddale Avenue and the northeast corner of West 36th Street and Wooddale Avenue. The site is divided by the CP Bass Lake Spur railroad tracks and the Cedar Lake LRT Regional Trail. It is adjacent to the future SWLRT Wooddale Avenue Station, and it is currently served by Metro Transit Bus Routes 615 and 17F along West 36th Street. The proposed redevelopment is near to Central Community Center, Park Spanish Immersion School and St. Louis Park High School. Nearby parks include Jorvig Park to the west, Center Park to the south, and Wolfe Park and Lilac Park to the east. Site Area: 5.2 acres Current Uses: Vacant land and vacant buildings Current Comprehensive Plan: MX-Mixed Use, BP-Business Park, OFC-Office, RRR- Railroad, Right-of-Way Current Zoning: I-G General Industrial, C-2 General Commercial Proposed Zoning: PUD-Planned Unit Development Surrounding Land Uses: North: Highway 7 East: Small scale commercial and Cityscape Apartments West: Wooddale Avenue South: West 36th Street / TowerLight City Council Meeting of April 17, 2017 (Item No. 8a) Page 4 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Site Location Map. Site Conditions: Topographically both sides of the development property are relatively flat. The proposed redevelopment site requires the assemblage of nine parcels. The north side of the proposed redevelopment includes the following four properties. •5925 Highway 7 is a vacant 1.16 AC remnant site. •5815 Highway 7 is a vacant 0.18 AC remnant site. •5725 Highway 7 is the former McGarvey Coffee manufacturing property. •3520 Yosemite is a vacant 0.4 AC remnant rail site. The south side of the proposed redevelopment includes the following five properties. •3565 Wooddale is a 0.065 AC parcel occupied by a 16,739 SF commercial building that was leased to Nash Frame. •3548 Xenwood Ave is a vacant 0.8 AC remnant rail site. •3575 Wooddale is an approximate 0.37 AC parcel. •5816 36th Street is an approximate 0.36 AC parcel which is part of a municipal parking lot constructed in 1976 for commercial parking purposes. •5814 36th Street is an approximate 0.25 AC parcel which is part of a municipal parking lot constructed in 1976 for commercial parking purposes. BACKGROUND: This area has been planned for redevelopment for over two decades. The Economic Development Authority and Hennepin County Regional Rail Authority have purchased properties in anticipation of redevelopment and transportation improvements, including the Highway 7 and Wooddale interchange and light rail transit SWLRT/Green Line Extension. There have been several land use, transportation, redevelopment, zoning, and transit corridor studies over that time. City Council Meeting of April 17, 2017 (Item No. 8a) Page 5 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Public Input: PLACE hosted numerous well attended public meetings from August 2015 until February 2017. The original program was located north of the rail corridor and was 12 to 14 stories tall. However due to traffic and height concerns, PLACE sought out an alternate program using both sides of the rail/trail corridor. The height of all buildings was reduced to be six stories or less. The applicant has sought the advice of the community in the overall design of the buildings, the site amenities, access into and out of the site, and the programming of the development. In addition to neighborhood meetings and meetings with the City Council and the Planning Commission, PLACE has also met with numerous agencies in the area including: Perspectives, St. Louis Park Historical Society, Friends of the Arts, STEP, SEEDS, St. Louis Park School Superintendent, St. Louis Park Health in the Park, Mu Performing Arts, Springboard for the Arts, experts from the University of Minnesota to discuss car-free living, Integrated Project Delivery, and winter greenhouses, and Partnership Resources. The 8th neighborhood meeting was held at Fire Station 1 on February 23, 2017. Approximately 60 people attended the meeting to review the development proposal. There were some attendees who supported the development, and others with concerns. Concerns generally related to: an increase in traffic, intersection congestion, congestion and sight lines over the Wooddale/Hwy 25 Bridge, amount of parking, the impact a hotel might have in the area, the inclusion of affordable housing, and the uncertainty of the SWLRT project. Comments of support generally included liking: the overall building design, the pedestrian and bicycle amenities, the inclusion of affordable dwelling units located close to reliable and frequent transit, the urban forest and proximity to the Cedar Lake Regional Trail, and the density of the development. Public Process for PLACE: •November 25, 2013: City Council Study Session – Introduction to PLACE •January 13, 2014: City Council Study Session – Project Update •September 22, 2014: City Council – Project Update •November 3, 2014: City Council Study Session – Project Update & McGarvey Site •May 18, 2015: City Council – Preliminary Development Agreement •August 8, 2015: 1 st Neighborhood Meeting – Fire Station 1 •September 30, 2015: 2nd Neighborhood Meeting – Fire Station 1 •November 17, 2015: 3rd Neighborhood Meeting – St. Louis Park High School •January 28, 2016: 4th Neighborhood Meeting – St. Louis Park High School •February 8, 2016:City Council Preliminary Development Agreement Amendment •May 9, 2016: City Council Study Session – Project Update •June 6, 2016: City Council Study Session – Project Update •June 20, 2016:City Council Preliminary Development Agreement Amendment •June 23, 2016: 5 th Neighborhood Meeting – Fire Station 1 •July 13, 2016: 6 th Neighborhood Meeting – Perspectives Family Center •July 28, 2016: 7 th Neighborhood Meeting regarding Traffic – Council Chambers •October 10, 2016: City Council Study Session – Project Update •January 18, 2017: Planning Commission Study Session – Overall Development •February 1, 2017: Planning Commission Study Session – Traffic and Parking •February 13, 2017: City Council Study Session – Project Update •February 21, 2017: City Council Preliminary Development Agreement Amendment •February 23, 2017: 8th Public Meeting – Fire Station 1 •March 6, 2017: Environmental Assessment Worksheet (EAW) distributed City Council Meeting of April 17, 2017 (Item No. 8a) Page 6 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD •March 15, 2017: Planning Commission Public Hearing •April 19, 2017: EAW comment period closes •April 17, 2017:City Council – First Reading •May 1, 2017:City Council – Second Reading Environmental Analysis: State rules, administered by the Minnesota Environmental Quality Board (EQB), requires an Environmental Assessment Worksheet (EAW) be completed for the PLACE development due to the number of residential units and gross square feet of commercial space. An EAW is designed to disclose information about the potential negative environmental effects a proposed development may have and methods to avoid or minimize any negative impacts before the project is permitted and built. An EAW analyzes the effects of a project on land use, zoning, geology and soils, water resources, stormwater, contamination, sensitive or endangered species, historic properties, noise, and traffic. The EAW for the PLACE development was completed by the consulting firm Stantec and was reviewed by the City of St. Louis Park and the city’s consultant Kimley Horn. It was approved for distribution by the City Manager on February 27, 2017. Notice of its availability was published in the EQB Monitor on March 6, 2017. The complete document is available for review on the city website, at city hall and the St. Louis Park Library. The comment period on the EAW will end on April 19, 2017. STAFF ANALYSIS: Comprehensive Plan Amendment: The applicant requests a change to the future land use designation of the development site to MX Mixed Use. Below is an excerpt from the Comprehensive Plan Land Use Map. It shows the subject properties guided for OFC - Office, BP – Business Park, RRR – Railroad, and Right-of-way, which are not consistent with the current zoning (I-P Industrial Park and C-2 General Commercial). City Council Meeting of April 17, 2017 (Item No. 8a) Page 7 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD ADDRESS Current Comp Plan Designation Proposed Comp Plan Designation Existing Zoning Proposed Zoning 5925 State Hwy 7 OFC-Office MX-Mixed Use I-G General Industrial PUD 5815 State Hwy 7 BP-Business Park MX-Mixed Use I-G General Industrial PUD 5725 State Hwy 7 BP-Business Park MX-Mixed Use I-G General Industrial PUD 3520 Yosemite Ave S. RRR-Railroad MX-Mixed Use I-G General Industrial PUD 5814 36th Street W. MX-Mixed Use MX-Mixed Use C-2 General Commercial PUD 5816 36th Street W. MX-Mixed Use MX-Mixed Use C-2 General Commercial PUD 3548 Xenwood Ave S. MX-Mixed Use MX-Mixed Use C-2 General Commercial PUD 3575 Xenwood Ave S. MX-Mixed Use MX-Mixed Use C-2 General Commercial PUD 3565 Xenwood Ave S. MX-Mixed Use MX-Mixed Use C-2 General Commercial PUD NA Right-of-Way MX-Mixed Use C-2 General Commercial PUD City Council Meeting of April 17, 2017 (Item No. 8a) Page 8 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD A request for amending the City’s land use plan and zoning map should be evaluated from the perspective of land use planning principles and community goals. These reflect the community’s long range vision and broad goals about what kind of community it wants to be and what makes strong neighborhoods. This amendment request is driven by a specific proposal for development. The request is for residential development at a density of approximately 57 units per acre, which is considered High Density (RH) in the Comprehensive Plan. Due to the proposed inclusion of office and commercial uses in the project, a change to MX – Mixed Use would be most appropriate. The amendment may be evaluated independently of the development proposal against the goals of the Comprehensive Plan for the subject properties. The amendment itself does not permit the proposed development, but is one step in the approvals process. General Consistency with the Comprehensive Plan The City’s land use plan should reflect the broad goals, policies and implementation strategies incorporated in the Comprehensive Plan. These elements are the basis for evaluating the requested change. The proposed re-guidance meets numerous Land Use, Housing, and Mixed-Use Goals and Policies in the City’s Comprehensive Plan, including: Livable Communities Goal #1: Provide attractive public streets and spaces that contribute to creating connections and a sense of community Policy 1-C: Incorporate “complete streets” design principles into future improvements of the community’s streets to accommodate all transportation modes where feasible. Policy 1-D: Provide pedestrian and bicycle pathways that connect key departure points and destinations throughout the City and require installation of identified connections during the redevelopment process. Policy 1-F: Promote high quality design of public and private open spaces that will benefit anticipated users with proper consideration given to use, design, maintenance, appearance, location, and accessibility of the space. Policy 1-G: Encourage placement of works of art, sculpture, or fountains throughout the City to help increase civic prominence and a unique sense of place where appropriate. Policy 1-K: Work with internal and external partners to ensure that all roadway and pedestrian facilities, including bridges, located in the City are functionally and aesthetically appealing and contribute to the use, overall design scheme (if appropriate), and enjoyment of the City. Residential Land Use Goals Goal #1: Create a mix of residential land uses and housing types to increase neighborhood housing choices and the viability of greater neighborhood services through redevelopment or infill development. City Council Meeting of April 17, 2017 (Item No. 8a) Page 9 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Policy 1-A: Consider opportunities for allowing a broader range of housing types and densities within or adjacent to existing low density residential neighborhoods that are complementary and compatible with the existing neighborhood character. Policy 1-B: Promote and support the development of medium and high density residential land uses near commercial centers and nodes. Policy 1-C: Ensure that new and redeveloped medium and high density residential land uses are located within walking distance of transit services. Mixed-Use Goals Goal #2: Pursue redevelopment of future transitway station areas as transit- oriented mixed-use center. Policy 2-A: Promote and support the Wooddale Station Area as a transit-oriented mixed- use neighborhood. Mixed-Use Goals Goal #3: Expand the development of mixed-use areas within St. Louis Park to create a more livable and connected community. Policy 3-A: Encourage and support mixed-use infill and redevelopment where the design of the project enables compatibility with existing surrounding land uses. Approving the Comprehensive Plan Land Use Map Amendment will allow for additional housing units, including affordable units, in an area that is well served by transit, and along a vibrant commercial corridor. The general area of the development proposal consists of a mix of smaller scale commercial buildings and several large mixed-use projects including Towerlight, a development for aging residents, and Hoigaard Village. To the southwest is Village in the Park, a community comprised of condos and townhome residential units. The Comprehensive Plan calls for an increase in the availability of neighborhood housing choices, mixed-use redevelopment and transit-oriented development. The proposed PLACE development would provide higher density apartment housing, including affordable units, in a building that enhances the street frontage along 36th Street and Wooddale Avenue and demonstrates principles of pedestrian- and transit-oriented development. The request to change the land use plan designations to MX Mixed Use is consistent with the adjacent properties to the south of the future Wooddale LRT station and properties located along West 36th Street, which are currently guided as MX Mixed Use. A mixed-use guidance would also complement the medium density residential land uses north of the rail line and immediately to the east. Availability of Infrastructure: •Water and Sewer: The City Engineer has reviewed the proposed development and found the public water and sanitary sewer infrastructure in the area to be adequate to serve the proposed development. •Traffic: A traffic study was completed and is attached to this report. The study includes an analysis of how the proposed development may impact the overall number of vehicle trips in the area as well as turning movements and the level of service of the following intersections: Wooddale Ave and Westbound Hwy 7 Ramp, Wooddale Ave and Eastbound City Council Meeting of April 17, 2017 (Item No. 8a) Page 10 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Hwy 7 Ramp, Wooddale Avenue and Hwy 7 Service Rd, Wooddale Avenue and West 36th Street, and West 36th Street and Xenwood Avenue. The Comprehensive Plan identifies Wooddale Avenue as a “Major Collector” and West 36th Street as a “Major Collector”, both of which have sufficient capacity for the proposed development. The development will of course generate additional trips based on redevelopment of the sites, but there are no significant changes to the intersection capacities and level of service (LOS) analyzed in the study. Approximately 300 total trips during the PM peak hour and 3,200 daily trips are generated by the development. A number of improvements are recommended to the transportation network to serve traffic in the area. These improvements include: •All SWLRT improvements •Widening of the Wooddale Avenue bridge to improve sight lines •A right-in/right-out intersection at the Wooddale and Hwy 7 Service Rd intersection with a southbound left-turn •Eastbound left turn lane at Xenwood Avenue and West 36th Street •Flashing yellow arrow signal heads for eastbound and westbound 36th Street at Xenwood Avenue •Travel demand management strategies including but not limited to parking space reductions and secure bicycle storage for residents and visitors. The project, with these mitigation improvements, shows minimal impact to the existing roadway in 2020. •Stormwater: City engineering staff finds that the developer complies with stormwater requirements through on-site mitigation and payment towards the Hoigaard stormwater detention pond that serves the area. The applicant will be required to obtain both City and Minnehaha Creek Watershed District permits prior to construction. Park Facilities The subject properties are located in an area with park and open space amenities. This area is close to Central Community Center, Park Spanish Immersion School and St. Louis Park High School. Nearby parks include Lilac Park to the east, Center Park to the south, and Jorvig Park to the west. St. Louis Park’s Rec Center/Wolfe Park is located within one-half mile of the proposed development. Place proposes constructing 0.88 acres of Urban Forest on site as an amenity to residents of the development and for the greater community. The Urban Forest will have play space for younger residents, and will provide an urban retreat for St. Louis Park, with walking trails and outdoor artwork. Impacts to Surrounding Properties and the Physical Character of the Neighborhood Removal of the existing buildings and redevelopment of the parcels will change the character of the site. The proposed development generally follows the height, density, and floor area ratios of the other mixed-use developments in the area. The proposed plans achieve the city’s vision for a mixed-use transit-oriented development at the Wooddale SWLRT Station as specified in the 2030 Comprehensive Plan. The development also achieves the city’s vision for this area that was established in the 2003 Elmwood Area Land Use, Transit, and Transportation Study. The City Council Meeting of April 17, 2017 (Item No. 8a) Page 11 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Elmwood study identified the parcels north of the rail line as high density residential with some lower density office/commercial space, and the parcels south of the rail line as a transit-oriented, mixed-use development. The Elmwood Area Land Use, Transit and Transportation Study Proposed Land Use Map The most noticeable impact to the area would be the addition of a greater number of residents and the addition of a hotel. An increase in residents and hotel guests provides a greater number of customers for local retail and activates the street frontage. Traffic is also increased consistent with an urban environment and adjacent to a major County highway. Additionally, the site design provides more onsite live/work opportunities to foster entrepreneurship and small artistic business startups in the area. The developer will also require 90 dwelling units to live car-free. This reduces traffic from the development’s residents, while increasing the small businesses along West 36th Street enhancing the vibrancy and identity of the corridor. City Council Meeting of April 17, 2017 (Item No. 8a) Page 12 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Staff finds the goals and policies of the 2030 Comprehensive Plan support reguidance of these properties to MX Mixed-use designation. Preliminary and Final Plat Analysis: PLACE is seeking approval to combine nine properties located in the northeast quadrant of the Wooddale Avenue and West 36th Street intersection to develop an energy generating, mixed-use, mixed-income, transit-oriented development. The proposed development includes 299 residential dwelling units (including 99 live/work units), 110 room hotel, a café, a coffee shop, a bike shop, a co-working space, a makers space, and an anaerobic digester. The plat will be named PLACE. Lots: The subdivision proposal will create three lots and three outlots. Lot 1, Block 1, PLACE will have a lot area of 1.1018 acres. This lot will be the location of the proposed E-generation and greenhouse building, 56 parking spaces, and a solar canopy. No residential development is proposed on this site. The proposed floor area ratio is 0.2. Lot 1, Block 2 PLACE will have a lot area of 2.2816 acres. The north residential building will be constructed on this lot. It will have 218 dwelling units, a 2,570 square foot bike shop and a 2,624 square foot Maker Space. The proposed residential density for this site is 95.56 units/acre. The proposed floor area ratio of the commercial space is 0.052, and 2.3 including the north residential building. Lot 1, Block 3 PLACE will be 1.7761 acres in size and will be the location of the 110 room hotel and the south residential building. The south residential building has 81 dwelling units. The proposed residential density for this site is 45.6 units/acre. The proposed floor area ratio of the hotel and commercial space is 0.91, and 3.2 including the south residential building. The overall density of the development is 57 unit/acre and the floor area ratio for the total development is 2.11. The plat will also create three outlots: Outlot A, Outlot B, and Outlot C. Outlot A is 0.1198 acres and is located between the Hwy 7 Frontage Rd and the Cedar Lake Regional Trail. Outlot B and Outlot C are 0.2349 acres and 0.2165 acres, respectively. They are located east of Yosemite Avenue and north of 35th Street, and will be owned by the City of St. Louis Park for future development opportunities. Easements: Lot 1, Block 1, PLACE is providing a 5 foot to 10 foot drainage and utility easement along the south property line, adjacent to the Hwy 7 Frontage Rd, and a 10 foot drainage and utility easement along Wooddale Avenue. Lot 1, Block 2, PLACE is providing a 10 foot drainage and utility easement along all property lines. The applicant is granting a 10 foot easement between Lot 1, Block 2 and Cityscape Apartments to construct a pathway connection to the Cedar Lake Regional Trail. PLACE has worked with the city and Three Rivers Park District to identify this future connection. Lot 1, Block 3 PLACE is providing 10 foot drainage and utility easements along West 36th Street and Wooddale Avenue, and a 5 foot easement along the north property line adjacent to the SWLRT line. PLACE has collaborated with the Southwest Project Office, Hennepin County, and the city City Council Meeting of April 17, 2017 (Item No. 8a) Page 13 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD to determine easement width to accommodate easements needed for the future Southwest LRT line. A 5 foot drainage and utility easement on the east side of the property is also provided. Right-of-Way Dedication: The City of St. Louis Park hired SRF in 2006 to analyze the street design of 36th Street to accommodate vehicular traffic while providing a welcoming streetscape for pedestrians and bicyclists. The enhancement design calls for a bike lane, and increased landscape materials in this area. PLACE is dedicating 26 feet (6,908 square feet) of right of way along 36th Street, and 10.5 feet (1,569 square feet) of right-of-way along on Wooddale Avenue to accommodate the city’s plans for these streets. In 2009 St. Louis Park obtained right-of-way along the south side of Hwy 7 to construct the Wooddale Avenue overpass and to reconstruct the Hwy 7 Frontage Rd. The city never platted this land and the current frontage road is not constructed in official right-of-way. The city is selling the surrounding land to PLACE for redevelopment, and PLACE is dedicating 41,328 square feet of right-of-way to the city. PLACE is also dedicating 22,332 square feet of right-of-way on the north side of Lot 1, Block, 1 to the Minnesota Department of Transportation for the Hwy 7 entrance ramp. Total right-of-way dedications equal 1.66 acres of land. Park Dedication: The Parks and Recreation Advisory Commission reviewed park and trail dedications for the proposed development on March 15, 2017. PRAC recommends cash-in-lieu of park land dedication. For mixed-use developments, the city collects dedication fees for each project component: residential portion based on dwelling unit, and the commercial/industrial portion based on 5% of the assessed value of land for the ground floor area of the commercial/industrial buildings. According to Hennepin County records, 5 parcels have been platted and four parcels are unplatted. It is assumed commercial/industrial dedication fees have already been paid for the platted parcels. Residential dedication fees for all parcels will need to be collected and commercial/industrial dedication fees for the unplatted parcels will need to be collected. The 2017 fee schedule sets the residential Park Dedication Fee at $1,500 per dwelling unit and the residential Trail Dedication Fee at $225 per dwelling unit. PRAC recommends PLACE dedicate $448,500 in park fees and $67,275 in trail fees for the residential portion of the development, and $16,963 for the commercial portion of the development located on unplatted parcels. The total cash-in-lieu dedication recommended by PRAC is $532,838. PUD Analysis: Description: The developer requests approval of a preliminary and final Planned Unit Development (PUD). A PUD is a rezoning and zoning text amendment that establishes the regulations for a specific property. The site is currently zoned I-P Industrial Park and C-2 General Commercial. The 5.2-acre site meets the minimum 2 acre requirement to request a Planned Unit Development. The use of a PUD zoning for this property is recommended as it allows for conditions and requirements that fit the context and character of the individual site and the proposed development at the SWLRT Wooddale station. City Council Meeting of April 17, 2017 (Item No. 8a) Page 14 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Building and Site Design Analysis: PLACE meets the PUD ordinance goals for building and site design. The ordinance requires the City to find that the quality of building and site design proposed will substantially enhance aesthetics of the site and implement relevant goals and policies of the Comprehensive Plan. In addition, the following criteria shall be satisfied: (1) The design shall consider the project as a whole, and shall create a unified environment within project boundaries by ensuring architectural compatibility of all structures, efficient vehicular and pedestrian circulation, aesthetically pleasing landscape and site features, and design and efficient use of utilities. Staff finds the plan meets this requirement. (2) The design of a PUD shall achieve compatibility of the project with surrounding land uses, both existing and proposed, and shall minimize the potential adverse impacts of the PUD on surrounding land uses and the potential adverse effects of the surrounding land uses on the PUD. Staff finds this criteria will be met. (3) A PUD shall comply with the City’s Green Building Policy. This is a condition of approval. The architect is working with Xcel Energy, Centerpoint Energy, and the City of St. Louis Park to comply. The buildings are also being designed to LEED standards. (4) The use of green roofs or white roofs and on-site renewable energy is encouraged. The development includes approximately 29,500 square feet of green roof. PLACE is also producing City Council Meeting of April 17, 2017 (Item No. 8a) Page 15 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD approximately 90% of all energy consumed by the development onsite through renewable energy sources including wind, solar, and bio-gas. Zoning: The following table provides the development metrics. The property will be rezoned to a Planned Unit Development (PUD). The proposed performance and development standards, as indicated in the development plans, establish the development requirements for this property if approved. Zoning Compliance Table. Factor Required Proposed Total Proposed A. E-gen Proposed B.North Proposed C. Hotel Proposed D. South Met? Use Office/Commercial/ Industrial Mixed-Use Mixed-Use Mixed-Use Mixed-Use Mixed-Use Yes Lot Area 2.0 acres 5.25 1.19 2.28 1.78 Yes Height None with PUD 1 story: 33ft Flute: 40ft Turbine: 75ft 5 stories: 61ft 6 stories: 76ft 6 stories: 79ft Yes Building Materials Minimum of 60% Class I materials 94.0% 81.9% 97.7% 98.0% 87.1% Yes Dwelling Units 299 0 218 81 Yes Hotel Rooms 110 110 Yes Density 50 units/acre, or more with PUD 57 0 95.6 45.6 Yes Floor Area Ratio None with PUD 2.11 0.2 2.3 3.2 Yes Ground Floor Area Ratio N/A 0.39 0.18 0.43 0.48 Yes Off-Street Parking Residential: 251 spaces •90 car free units (none required) •Studios & 1 bedroom: 1 per unit •2, 3, & 4 bedroom: 2 per unit Commercial: 281.4 spaces •Hotel: 1 per room •Restaurant: 1 per 80sf •Coffee shop: 1 per 400sf •Co-working: 1 per 500sf •Makers Space: none required •Retail: 1 per 500sf •E-gen/greenhouse: 2 spaces Car Share: 10 spaces •1 per car Total: 447 spaces required 447 Electric Car Charging Stations: 3% E-gen: 2 Total: 2 Electric Car Charging Stations: 3% Residential: 206 Commercial:7 Car Share: 5 Total 218 Electric Car Charging Stations: 3% Hotel: 110 spaces Residential: 58 Commercial: 54 Car Share:5 Total: 227 Electric Car Charging Stations: 3% Yes Bicycle Parking 1 per dwelling unit plus one per ten automobile spaces: 10% of commercial spaces Total: 344 required 494 8 327 159 Yes Page 16 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD City Council Meeting of April 17, 2017 (Item No. 8a) Page 17 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Factor Required Proposed Total Proposed A. E-gen Proposed B. North Proposed C. Hotel Proposed D. South Met? Open Area/DORA No specific percentage with PUD 16.4% Yes Landscaping See Landscaping section Yes Setbacks None with PUD 36th Street Streetscape = ~10 North: 0’ South: 5’ East: 35’ West: 4’ to 31’ North: 10’ South: 29’ East: 10’ West: 5’ North: 5’ South: 10’ East: 0’ West: 5’ North: 40’ South: 10’ East: 10’ West: 0’ Yes Mechanical Equipment Full screening required Provided: Any proposed rooftop equipment shall be screened by parapet so as not visible from off-site. Yes Sidewalks Required along all street frontages Provided along all street frontages Yes Refuse handling Full screening required Provided: Garbage, Organics, & Recycling Yes Transit service None required Future SWLRT Wooddale Station & Greenline Metro Transit Route: 615 Yes Stormwater Management None required >1 Acre: Stormwater will be retained on site & developer will contribute money to the Hoigaard Detention Pond Yes Uses: PLACE proposes to develop a mixed-use, mixed-income community for creatives. The proposal includes: •299 apartments (200 affordable, 99 market-rate), including 99 mixed-income live/work •110-room Fairfield hotel by Marriott •Café, coffee house, bike shop, and five microbusinesses •Maker’s space and Co-working space •PLACE’s E-Generation facility on the northern site, which uses PLACE’s patent-pending portfolio of renewable energy systems to convert locally-sourced organic waste into energy for the project and a soil amendment byproduct that will be used in the onsite greenhouse. •0.88 acres of urban forest, for public access to nature, stormwater management, and habitat •29,500 square feet of greenroof for additional stormwater management and habitat •Solar panels on roofs and vertically integrated into the building facades •Surface and underground parking on the northern site as well as underground parking south of the rail, which leaves ground space for a “woonerf/placemaking plaza” adjacent to the LRT station to provide pedestrian-oriented multiuse space The 299 dwelling units are comprised of a mix of studios, 1 bedroom, 2 bedroom, 3 bedroom, and 4 bedroom units. 200 dwelling units (66.8%) will be designated as affordable at 60% area median income. The community will be marketed toward creative entrepreneurs and 99 of the 299 dwelling units will be designed as live/work units. PLACE proposes two styles of live/work units: live/work Type I and live/work Type II. There are 94 live/work Type I units that will include a large working space within the dwelling unit, but no physical storefront. 18 live/work Type I units are located on the north site and 76 units on the south site. Live/work Type II includes a large work space within the dwelling units and storefronts. There are no live/work Type II dwelling units on the north site, and five on the south site. Three units are located along West 36th Street and two are located near the woonerf/place-making plaza. There is also a small store front on the east side of the south residential building that acts as a rotating gallery/storefront for residents living in live/work Type I. UNIT SUMMARY NORTH RESIDENTIAL TYPE LEVEL 1 live/work LEVEL 1 LEVEL 2 LEVEL 3 LEVEL 4 LEVEL 5 TOTALS DWELLING STUDIO 12 4 17 17 17 17 84 1 BEDROOM 0 6 17 17 17 17 74 2 BEDROOM 3 0 8 8 8 8 35 3 BEDROOM 3 4 4 4 4 4 23 4 BEDROOM 0 2 0 0 0 0 2 TOTAL 18 16 46 46 46 46 218 Page 18 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD City Council Meeting of April 17, 2017 (Item No. 8a) Page 19 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD UNIT SUMMARY SOUTH RESIDENTIAL TYPE LEVEL 1 & 2 live/work 2 LEVEL 3 live/work LEVEL 4 live/work LEVEL 5 live/work LEVEL 6 live/work TOTALS STUDIO 0 12 12 12 12 48 1 BEDROOM 0 4 4 4 4 16 2 BEDROOM 5 2 2 2 2 13 3 BEDROOM 0 1 1 1 1 4 4 BEDROOM 0 0 0 0 0 0 TOTAL 5 19 19 19 19 81 The development includes a 110-room Fairfield hotel by Marriott. There are 27 double rooms, 58 king rooms, 24 extended stay suites, and one presidential suite. The hotel includes a lobby, a pool, a fitness center, a small business center, and a bar. There are no large conference spaces provided in the hotel. Located on the ground floor of the hotel is a 1,173 square foot coffee house located near the Wooddale LRT Station platform, and a 4,644 square foot restaurant/café. The café’s main entrance is located along West 36th Street between the hotel and south residential building. Outdoor seating is proposed along West 36th Street. A 7,675 square foot leasing office and a 1,571 square foot co-working space are located on the ground floor of the south residential building. There is also 2,415 square feet of co-working space located on the second floor of the building. The co-working space is designed to provide for a shared office and large artistic workspace for artists. People who live outside the development are able to lease portions of the co-working space. Linking the hotel and the south residential building is a fourth floor bridge. The bridge will connect the live/work and hotel buildings with a multipurpose space. This creates a pathway for hotel guests to explore live/work studios during specific visiting days when creatives open their doors to the public. Also located on the south site is a Woonerf or Placemaking Plaza. The placemaking plaza is located between the hotel and south residential building adjacent to the SWLRT Wooddale Station area platform. The placemaking plaza is primarily a pedestrian plaza that is open to cars and bicyclists. This space can be programmed to host outdoor events, and will be infused with native landscaping and artwork. A wide “mews” passage will connect 36th Street to the woonerf and LRT station, with potential for live/work and café activity to expand into the space. On the ground floor of the north residential building there is 2,484 square feet of retail space and 2,624 square feet of Maker Space PLACE proposes the retail space be a bike shop to serve the community and people utilizing the Cedar Lake Regional Trail. The Maker Space is a membership- driven studio that provides access to everything someone needs to make things; instruction, tools, software, and space. Maker Space is an open-access, DIY workshop and fabrication studio. Other site amenities for residential units include indoor bicycle storage, exercise rooms, sound proof rooms, storage, laundry facilities, play structures, and the urban forest. City Council Meeting of April 17, 2017 (Item No. 8a) Page 20 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Located on the corner of Wooddale and Hwy 7 Frontage Rd is PLACE’s patent-pending E- Generation system, located in a 4,500 square foot building and a 2,472 square foot greenhouse. The E-generation system provides renewable energy and food generation. The system actively balances electricity generation from solar, wind, cogeneration, and anaerobic digestion. The completely enclosed anaerobic digestion element will convert locally-sourced food waste into methane for electricity. The soil amendment and excess heat byproducts from the anaerobic digestion process will support a greenhouse growing food year-round. Architectural Design: LEED: PLACE proposes to design the entire project to LEED standards. This would be the first LEED certified project in St. Louis Park. Materials: The applicant is requesting Nichiha, a large format high performance fiber cement rain screen cladding system, and Enduramax, an integrated insulation with brick veneer high performance rain screen cladding system be considered Class I Materials. These materials are proposed due to their sustainability features and long-term warranties on both materials and installation. PLACE also proposes installing vertically integrated photovolic panals (solar panels) as part of the building’s façade. This material would qualify as a Class I glass material under city code. Staff are supportive of the use of these products as Class I materials in this development. Design: The proposal is for a six-story mixed-use hotel at the intersection of Wooddale Avenue and West 36th Street, a six-story mixed-use building along West 36th Street, a one-story E-generation building in the southeast quadrant of Wooddale Avenue and Hwy 7, and a 5 story mixed-use residential building along the Hwy 7 Frontage Rd. The mixed-use hotel is designed to be pedestrian friendly along the right-of-way, with large transparent windows, but to but to deter LRT drop-offs from occurring on Wooddale and West 36th Street. The main entrances to the hotel and coffee shop are located on the east side of the building, facing the woonerf/place-making plaza and the LRT station. The primary entrance to the café is located along West 36th Street located close to the south residential building. The south residential building’s main pedestrian entrance is opposite the café, also on West 36th Street. There is also access from the south residential building to the woonfer. Live/work Type II storefronts comprise the remainder of the first floor West 36th Street frontage. The primary building materials are fiberous cement (Nichiha), brick veneer (Enduramax), glass and solar panels. The first floor of the two south buildings are Enduramax and floors two through six are two colors of Nichiha. Integrated near the top of the building are vertically integrated solar panels. The eastern façade of the parking garage is cladded in a metal screen that can be utilized as a green wall, and has metal panels that will be used for public art. All facades of the hotel and residential building are comprised of more than 85% of Class I materials. The bridge linking the hotel and south residential build is located on the fourth floor and is constructed out of metal and glass. 76.5% of the north and south facades are comprised of Class I materials. City Council Meeting of April 17, 2017 (Item No. 8a) Page 21 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD The north residential building materials are similar to the buildings on the south site. The first floor is cladded in Enduramax, while floors two through five are a combination of Nichiha and vertically integrated solar panels. The building wraps around the 0.88 acre urban forest to the south, and is oriented to follow the frontage road to provide a welcoming pedestrian realm. The building is primarily 5 stories in height, except for the building’s west wing, which is one story in height with a rooftop amenity. The one story portion of the building is the location of the retail and Maker Space. All facades are comprised of at least 98% Class I materials. There is a 16’-4” helical wind turbine proposed on the roof of the north residential building. The wind turbine is 3’- 5” wide, and is located in the middle of the building at the location of a slight bend in the building structure. The E-generation building is a one to two story building. It is designed to be a prominent component of the community, highlighting the development’s dedication to sustainability and desire to produce energy on site. The primary façade materials include Nichiha, glass, and metal panels. The design is intended to showcase the industrial aspect of E-generation. All facades are comprised of at least 60% Class I materials. Height: The hotel is proposed to be 6 stories or 75 feet 9 inches in height. The south residential building is proposed to be 6 stories or 78 feet 8 inches in height. The north residential building is proposed to be 5 stories or 60 feet 2 inches in height. PLACE’s E-generation building is proposed to be 1 to 2 stories or 32 feet 10 inches in height. There is one ventilation tower at 39 feet 4 inches tall. The solar canopy over the off-street parking lot is 18 to 20 feet tall. Lighting: The current photometric plan meets the recommended level of 0.5-1 foot candle past the property line. The LED lighting features chosen are consistent with the aesthetic features of the building and are not anticipated to present a nuisance to neighboring properties. Access: Vehicular: Vehicular access to the north site is from the Hwy 7 Frontage Rd via Wooddale Avenue. The Wooddale Avenue intersection will be reconfigured to a right-in/right-out and a southbound left in. A left turn from the frontage road onto Wooddale Avenue will be prohibited. There will be two-way access to the E-Generation building to accommodate vehicles bringing organic material to the building, and for residential parking. The north residential building will be accessed via the Hwy 7 Frontage Road. A driveway on the south side of the frontage road will be used to access the underground parking garage. The hotel and south residential building will be accessed via a driveway off West 35th Street and Yosemite Avenue. Traffic will come from West 36th Street and Yosemite Avenue or West 36th Street and Xenwood Avenue. Xenwood Avenue is a signalized intersection, providing for controlled vehicular movements in all directions. It is likely all traffic entering or exiting the development wishing to make a left turn will utilize the signalized intersection at Xenwood Avenue. The hotel and south residential building can also be accessed through a right-in/right-out entrance through the community’s south parking garage. Emergency access will occur from the 35th Street/Yosemite Avenue driveway, however, the area between the hotel and south residential building is designed to accommodate emergency response vehicles including fire trucks. City Council Meeting of April 17, 2017 (Item No. 8a) Page 22 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Cedar Lake Regional Trail: PLACE has worked with the Three Rivers Park District to facilitate two new trail connections from the public right-of-way. One of the access points is located between the PLACE north residential building and the Cityscape apartments. The second access point is located on the west side of the north residential building, and is designed to accommodate higher bicycle and pedestrian traffic that may want to utilize the bike shop located directly off the trail. PLACE is working with Three Rivers to design these access points to meet the Park District’s standards. Wooddale Station: PLACE has collaborated with the SWLRT Project Office to design the project with the LRT station in mind. A SWLRT kiss and ride is located near the 35th Street/Yosemite Avenue driveway, and PLACE has made every effort to include the SWLRT plans into the proposed development plans. PLACE has also worked with the city and the Project Office to design the development to discourage drop-offs along West 36th Street and Wooddale Avenue. Loading/Service Areas: The north residential building has trash, recycling, and organic material collection occurring on the first floor of the building, with direct service access to the Hwy 7 Frontage Road. The hotel service and trash areas are located on the first floor with direct access to the woonerf/place-making plaza. Trash, recycling, and organic material will be collected on the first floor of the south residential building. Organic material will be collected from the site and transported to the E-Generation building. A residential loading zone is provided near the entrance to the parking garage for the north residential building, and a residential loading area is provided in the wonder/place-making plaza for the south residential building. There are also areas for loading within the south parking garage. Mobility Plan: PLACE proposes to develop a community that encourages a lifestyle where residents can easily live car-free. To facilitate car-free living PLACE has developed a robust mobility and transportation demand management plan. PLACE will provide a car-free perks package to 90 household on a first-come, first-served basis. For car-free households, PLACE will pay annual memberships in car-sharing and bike-sharing programs, pay a monthly cash stipend, and provide Go-To passes with a modest monthly starting balance. A mobility concierge will help connect people with transit options to make smooth connections and to help overcome technological unfamiliarity. PLACE is not able to predict which apartments will be car-free. Given the size of the cash stipend PLACE is able to offer and greater bicycle and car-sharing experience among younger people, PLACE predicts early participation from the one- and two-bedroom households, especially in the live/work component. Households will register their vehicles by license number with the management company. Those who choose to be car-free and receive the benefits must agree as part of their lease that they will remain car- free. Residential parking entry, likely controlled by swipe card or fob, will be programmed by apartment accordingly. Car share cars will have their own swipe cars, so that car-free residents may still use parking when in a car share vehicle. Parking: Parking will total 447 stalls for the overall development. After extensive research of parking in transit-oriented developments, city staff feel that rational parking discounts are warranted due to the development’s proximity to light rail and PLACE’s robust mobility plan and dedication to provide a car-free living environment. Discounts to parking are given based on Exhibit 62 of the Official Exhibits. City Council Meeting of April 17, 2017 (Item No. 8a) Page 23 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD A total of 216 parking spaces are located north of the rail line. PLACE is providing 61 on street parking stalls along the Highway 7 Frontage Rd, 56 parking spaces in an off-street parking lot located between E-Generation and the north residential building, and 99 spaces in an underground garage. 231 parking spaces are located south of the rail line. 227 parking spaces are provided in a four story parking garage, and four spaces are located within the woonfer, or place-making Plaza. There are no parking spaces located along West 36th Street or Wooddale Avenue. Staff commissioned Walker Parking Consultants to analyze PLACE’s parking proposal and mobility plan, city parking discounts, and to share their expertise in shared parking and parking requirements for transit-oriented development. Walker studied the city’s existing zoning ordinance, other cities’ zoning ordinances, and case studies in similar cities. Walker also applied their shared parking model to analyze PLACE’s proposed parking. The Walker Parking Consultant study found that there is some risk with the amount of parking PLACE is providing, but with all mitigations in place, the Walker Shared Parking Model suggests that the parking and development proposed by PLACE could supply sufficient parking. The Walker shared parking model examined peak parking hours for both week day and weekend use. The shared parking model found there to be sufficient spaces during the week, and a 1 vehicle deficit on the weekend when 443 parking spaces were proposed. PLACE is providing 447 parking spaces in the submitted plans. The programming of the parking spaces is still being determined, but it is likely that parking spaces on the north side of the property will be assigned to individual units, while parking on the south site will have more opportunities for shared use. On-street parking will be permitted to prevent LRT park and ride parking. There are designated LRT park and ride ramps located at the future Beltline LRT Station and Louisiana LRT Station, both within St. Louis Park, and park and ride activities are discouraged at the Wooddale Station. Electric Vehicle Parking: PLACE has provided 15 electrical vehicle charging stations throughout the development. 5 Electric car charging stations are located in the south parking garage, 5 in the north residential underground garage, and 5 located in the off-street parking lot near E-Generation. Bicycle Parking: Total bicycle parking provided for the project exceeds the required 344 spaces. The applicant has provided 494 bicycle parking stalls, 335 of which are located on the north site and 159 on the south site. There are 8 outdoor bicycle parking spaces at the E-Gen building, 24 outdoor bicycle parking spaces at the north residential building, and 24 spaces located on the south site; 12 spaces are located near the Wooddale Station area platform and 12 spaces are located on West 36th Street. There is one bicycle parking space located at each underground parking stall, except the stalls with electric charging stations, and a dedicated 2,650 square foot bicycle storage room in the north residential building. Transit Access: This property is located at the future Wooddale Southwest LRT station, and is served by Metro Transit Bus Route 17 and 615. Landscaping: The landscape plan indicates 245 deciduous trees, 12 coniferous trees, 8 ornamental trees and 422 shrubs. The project does not meet the city’s planting and tree replacement requirements, however, the plan includes provided a variety of alternative landscaping measures in order to meet the intent of the landscaping ordinance. These alternative measures include: 29,500 square feet of greenroofs, a woonerf/place-making space, outdoor play structures, fireplaces, outdoor space located on the roof, and plentiful public art. The landscaping along West 36th Street exceeds the suggested landscaping plan completed by SEH in 2006 and the landscaping City Council Meeting of April 17, 2017 (Item No. 8a) Page 24 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD on Wooddale Avenue will enhance the pedestrian realm and will deter drop-offs along both street frontages. Designed Outdoor Recreation Area (DORA): The plan exceeds the City’s minimum 12% DORA requirements, and provides approximately 16.4% of DORA. The proposed development plans illustrate DORA through the inclusion of the 37,575 square feet of designed outdoor space. PLACE proposes 33,560 square feet of urban forest located adjacent to the Cedar Lake Regional Trail. The urban forest will provide active outdoor space for both residents of the development and the greater St. Louis Park community. Within the urban forest programmed space will include play equipment and residential amenities (fire pits, grills, outdoor seating) and informal walking paths. Public art installments will also be incorporated into the urban forest. In addition, the northern residential building includes 1,376 square feet of shared balcony space and 735 square feet of rooftop amenity space. The shared balcony space is located on the east side of the building, with views to downtown Minneapolis, while the rooftop space is located on the west side of the building near the bike shop and the entrance to the regional trail. The south site includes 728 square feet of rooftop space located above the bridge between the hotel and the residential building, and 424 square feet of performance space located in the Place-making Plaza. A 752 square foot dog run is located on the east side of the residential building. Public Art: As a community for creatives, PLACE proposes a vigorous public art plan throughout the development. Beyond live/work, art will be integrated throughout the site via art installations curated by the Museum of Outdoor Arts. Community-led art components will involve collaboration with local artists, schools, and organizations. 8 to 10 art installations will be interwoven into the urban forest, and additional pieces will be installed in the woonerf, and other publicly accessible pedestrian areas within the development, including areas on the buildings themselves. Multipurpose spaces will feature exhibits and presentations from creatives as well as host community gatherings. PLACE is also working with the city to maintain and reuse the existing public art that is located along W. 36th Street. Sustainability and Energy Efficiency: Every inhabitant of the development will benefit from low energy costs; the Project will produce approximately 90% of its own energy, achieve LEED certification, and meet Minnesota Green Communities criteria. PLACE’s patent-pending E-Generation system will bring additional benefits to the development and the broader community with renewable energy and food generation. The system actively balances electricity generation from solar, wind, and anaerobic digestion. The completely enclosed anaerobic digestion element will convert locally-sourced food waste into methane for electricity. The soil amendment and excess heat byproducts from the anaerobic digestion process will support a greenhouse growing food year-round. The E-Generation facility will hold the anaerobic digestion, energy storage, and greenhouse, and will be placed in a highly visible location on Wooddale to showcase the state-of-the-art energy generation equipment and greenhouse. Organization and school tours will offer a deeper dive into understanding the inner workings of E-Generation. The city adopted zoning regulations to allow for anaerobic digesters in April 2014. Those regulations allow for a system that processes up to 30,000 tons of material annually to be located City Council Meeting of April 17, 2017 (Item No. 8a) Page 25 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD in an I-G General Industrial zoned parcel, which is the current zoning for the E-Generation parcel. The ordinance established the conditions related to odor control, noise, operating procedures, storage, and permitting relating to anaerobic digestion. These regulations were adopted based upon research and expertise from the Minnesota Pollution Control Agency, planning staff in other cities, environmental specialists, Hennepin County organics/recycling staff, managers of other digesters, and professors at the University of Minnesota. City staff included Building Official, Fire Marshal, Planning, and Operations staff. E-Generation will be required to adhere to the city’s zoning regulations for anaerobic digesters. PLACE’s E-Generation system will process approximately 1,100 tons of organic material annually, with a maximum capacity of 3,000 tons annually. This is one-tenth the material allowed under the existing zoning. The building and all internal systems will be built to all applicable building and fire codes, and in accordance with any other required permits. The organic material will be collected from within the PLACE development and possibly from a local brewery. Approximately one trip per day with 6 to 10 55-gallon plastic drums will be picked up from the brewery and will be brought to the E-Generation facility. The drop off will occur within the confines of the building. The organic waste material collected from within the PLACE development will occur on a daily basis with approximately two trips per building per day. The drop off happens within the confines of the building. A small electric cart will be used to deliver organic material to the facility. A total of 10 electric cart trips per day will supply all of the organic material needed to operate the E-Generation system. All materials will be transported to E-Generation in lidded containers and will be unloaded within the confines of the building. The system employs negative pressure and triple-redundant carbon filtering to eliminate any odors. The zoning ordinance and the language in the PLACE PUD prohibits any odors from being detectable outside of the building containing the digester system. The byproduct of E-Generation is organic feed that is dried to 80 percent. No odor can be detected and the finished feed material will go out on 40”x42” pallets. Up to 14 pallets of material will be picked up weekly. The pickup will be every other day to twice a week depending upon output. The door will open and material will be loaded to a cube truck. This will be done with an electric fork. Returned pallets will be stacked internally and will not be placed outside. As part of E-Generation, a greenhouse will produce enough organic food to fill subscriptions to 300 Community Supported Agriculture (CSA) shares for the PLACE community. There is a cold storage unit for storing produce within the E-Generation facility and food will be shuttled through the PLACE development using the electric vehicle. Loading will happen internally with a vestibule. Solar photovoltaic panels will be located throughout the site on building roofs, over the surface parking lot, and incorporated into building façades. A helical wind turbine will be located on the top of the north residential building. The wind turbine is 3’5” in width and 16’4” tall. It will be installed in the middle portion of the north residential building. The wind turbine’s fall zone is located completely on PLACE’s property and does not pose a risk to adjacent properties. The applicant proposes illuminating the wind turbine, showcasing PLACE’s use of renewable energy sources. The city’s zoning ordinance allows wind turbines and the Planning Commission is supportive of the helical wind turbines location on the roof of a building verses ground-mounted wind energy. City Council Meeting of April 17, 2017 (Item No. 8a) Page 26 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Signs: A sign plan was not submitted for review. Signs will require permits and shall comply with the MX Mixed Use District standards. Utilities: All small utilities will be placed underground. Utility service structures, such as a generator and transformer, will be screened completely from off-site with materials consistent with main building facade. Per the development agreement, buildings will provide the necessary infrastructure to take advantage of fiber-optic service lines in the vicinity of the development. Maintenance: The south hotel and residential buildings are located within Special Service District #6. The property owner pays a special service assessment annually, and the city provides landscaping and street maintenance for the 36th Street streetscape. The properties will remain in Special Service District #6. PLACE will be required to maintain all other streetscape maintenance responsibilities and any privately owned site amenities including public art, trails, and the urban forest. Maintenance details will be addressed in the Planning Development Contract. PLANNING COMMISSION: The Planning Commission held a public hearing on March 15, 2017 to gather comments on the PLACE development. Three people voiced concerns regarding the development and asked that the decision be delayed. Four people spoke in favor of the development. Concerns included increased traffic, concerns regarding lessened parking requirements, dislike of the six-story height, concerns about the uncertainty of LRT construction, and safety concerns with the development’s affordable component. Comments of support for the development included support for artistic communities, desire to live car-free, supportive of live-work opportunities, and supportive of opportunities to better the health of families through walkability and sustainability. The Planning Commission voted 5 to 0 to recommend approval of the Comprehensive Plan Amendment, and voted 4 to 1 to recommend approval of the preliminary and final plat and the preliminary and final Planned Unit Development with conditions recommended in the staff report. STAFF RECOMMENDATIONS: Staff recommends approval of The PLACE Comprehensive Plan Amendment: Staff recommends approval of the requested Comprehensive Plan Amendment changing the land use designation on the map from OFC - Office, BP – Business Park, RRR – Railroad, and Right-of- way to MX-Mixed Use. Staff recommends approval of The PLACE Preliminary and Final Plat subject to the following conditions: 1.The site shall be developed, used and maintained in accordance with the conditions of this ordinance, approved Official Exhibits, and City Code. 2.All utility service structures shall be buried. If any utility service structure cannot be buried (i.e. electric transformer), it shall be integrated into the building design and 100% screened from off-site with materials consistent with the primary façade materials. 3.Prior to the City signing and releasing the final plat to the developer for filing with Hennepin County: City Council Meeting of April 17, 2017 (Item No. 8a) Page 27 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD a.The developer shall pay to the city the park dedication fee of $448,500 and trail dedication fee of $67,275 for residential uses and $16,963 for commercial uses. b.A financial security in the form of a cash escrow or letter of credit in the amount of $1,000 shall be submitted to the City to insure that a signed Mylar copy of the final plat is provided to the City. c.A Planning Development Contract shall be executed between the City and Developer that addresses, at a minimum: i.The installation of all public improvements including, but not limited to: sidewalks, boulevards, and the execution of necessary easements related to such improvements. ii.A performance guarantee for 1.25 times the estimated costs for the installation of all public improvements, placement of iron monuments at property corners, and the private site stormwater management system and landscaping. d.The applicant shall reimburse City Attorney’s fees in drafting/reviewing such documents as required in the final plat approval. e.The Mayor and City Manager are authorized to execute the Planning Development Contract. 4.Prior to starting any land disturbing activities, the following conditions shall be met: a.Proof of recording the final plat shall be submitted to the City. b.Assent Form and Official Exhibits shall be signed by the applicant and property owner. c.A preconstruction meeting shall be held with the appropriate development, construction, private utility, and City representatives. d.All necessary permits shall be obtained. e.A performance guarantee in the form of cash escrow or irrevocable letter of credit shall be provided to the City of St. Louis Park for all public improvements (street, sidewalks, boulevards, utility, street lights, landscaping, etc.) and the private site stormwater management system and landscaping. Staff recommends approval of The PLACE Preliminary and Final Planned Unit Development subject to the following conditions: 1.The site shall be developed, used and maintained in accordance with the conditions of this ordinance, approved Official Exhibits, and City Code. 2.All utility service structures shall be buried. If any utility service structure cannot be buried (i.e. electric transformer), it shall be integrated into the building design and 100% screened from off-site with materials consistent with the primary façade materials. 3.Prior to starting any land disturbing activities, the following conditions shall be met: a.Assent Form and Official Exhibits shall be signed by the applicant and property owner. b.A preconstruction meeting shall be held with the appropriate development, construction, private utility, and City representatives. c. All necessary permits shall be obtained. 4. Prior to issuance of building permits, the following conditions shall be met: City Council Meeting of April 17, 2017 (Item No. 8a) Page 28 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD a. The developer shall sign the City's Assent Form and the Official Exhibits. b.A Planning Development Contract shall be executed between the Developer and City that addresses, at a minimum: i.The conditions of PUD approval as applicable or appropriate. ii.The installation of all public improvements including, but not limited to: on-street parking, sidewalks and boulevard improvements and the execution of any necessary agreements related to the maintenance of such improvements including the inclusion of Special Service District #6. iii.The developer’s contribution of $48,200 to the City for regional stormwater pond improvements. iv.Developer agrees to provide art work on or near the site with city/public involvement in the selection of the location, artist, and art work. v.Easements related to electronic communication and fiber infrastructure. vi.A performance guarantee in the form of cash escrow or irrevocable letter of credit shall be provided to the City of St. Louis Park in the amount of 1.25 times of the costs of all public improvements (sidewalks and boulevards), and the private site stormwater management system and landscaping. vii.The developer shall reimburse City attorney’s fees in drafting/reviewing such documents as required in the final PUD approval. viii.The Mayor and City Manager are authorized to execute said Planning Development Contract. c.Final construction plans for all public improvements and private stormwater system shall be signed by a registered engineer and submitted to the City Engineer for review and approval. d.Building material samples and colors shall be submitted to the City for review and approval. 5. The developer shall comply with the following conditions during construction: a.All City noise ordinances shall be complied with, including that there be no construction activity between the hours of 10 p.m. and 7 a.m. Monday through Friday, and between 10 p.m. and 9 a.m. on weekends and holidays. b.The site shall be kept free of dust and debris that could blow onto neighboring properties. c.Public streets shall be maintained free of dirt and shall be cleaned as necessary. d.The City shall be contacted a minimum of 72 hours prior to any work in a public street. e.Work in a public street shall take place only upon the determination by the City Engineer (or designee) that appropriate safety measures have been taken to ensure motorist and pedestrian safety. f.The developer shall install and maintain chain link security fencing that is at least six feet tall along the perimeter of the site. All gates and access points shall be locked during non-working hours. g.Temporary electric power connections shall not adversely impact surrounding neighborhood service. 6.Prior to the issuance of any permanent certificate of occupancy permit the following shall be completed: a.Public improvements, private utilities, site landscaping and irrigation, and storm water management system shall be installed in accordance with the Official Exhibits. City Council Meeting of April 17, 2017 (Item No. 8a) Page 29 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD 7.All mechanical equipment shall be fully screened. Rooftop equipment may be located as indicated in the Official Exhibits so as not to be visible from off-site. 8.The materials used in, and placement of, all signs shall be integrated with the building design and architecture. 9.Bicycle parking on site shall be located within fifty feet of the building’s front entrance. City Council Meeting of April 17, 2017 (Item No. 8a) Page 30 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Aerials City Council Meeting of April 17, 2017 (Item No. 8a) Page 31 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD D R A F T RESOLUTION NO. 17-____ RESOLUTION SUPPORTING THE APPROVAL OF AN AMENDMENT TO THE 2030 COMPREHENSIVE PLAN FOR THE CITY OF ST. LOUIS PARK UNDER MINNESOTA STATUTES 462.351 TO 462.364 FOR THE PROPERTY LOCATED AT THE SOUTHEAST QUADRANT OF HIGHWAY 7 AND WOODDALE AVE AND THE NORTHEAST CORNER OF WEST 36TH STREET AND WOODDALE AVENUE WHEREAS, the 2030 Comprehensive Plan was adopted by the City Council on December 21, 2009 and provides the following: 1.An official statement serving as the basic guide in making land use, transportation and community facilities and service decisions affecting the City. 2.A framework for policies and actions leading to the improvement of the physical, financial, and social environment of the City, thereby providing a good place to live and work and a setting conducive for new development. 3. A promotion of the public interest in establishing a more functional, healthful, interesting, and efficient community by serving the interests of the community at large rather than the interests of individual or special groups within the community if their interests are at variance with the public interest. 4.An effective framework for direction and coordination of activities affecting the development and preservation of the community. 5.Treatment of the entire community as one ecosystem and to inject long range considerations into determinations affecting short-range action, and WHEREAS, the use of such Comprehensive Plan will insure a safer, more pleasant, and more economical environment for residential, commercial, industrial, and public activities and will promote the public health, safety, and general welfare, and WHEREAS, said Plan will prepare the community for anticipated desirable change, thereby bringing about significant savings in both private and public expenditures, and WHEREAS, the Comprehensive Plan has taken due cognizance of the planning activities of adjacent units of government, and WHEREAS, the Comprehensive Plan is to be periodically reviewed by the Planning Commission of the City of St. Louis Park and amendments made, if justified according to procedures, rules, and laws, and provided such amendments would provide a positive result and are consistent with other provisions in the Comprehensive Plan, and WHEREAS, the Planning Commission of the City of St. Louis Park held a Public Hearing and recommended adoption of an amendment to the 2030 Comprehensive Plan on March 15, 2017, City Council Meeting of April 17, 2017 (Item No. 8a) Page 32 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD based on statutes, the Metropolitan Regional Blueprint, extensive research and analyses involving the interests of citizens and public agencies; WHEREAS, the City Council has considered the advice and recommendation of the Planning Commission (Case No. 17-04-CP); WHEREAS, the contents of Planning Case File 17-04-CP are hereby entered into and made part of the public hearing record and the record of decision for this case; NOW THEREFORE BE IT RESOLVED by the City Council of St. Louis Park that the Comprehensive Plan, as previously adopted by the Planning Commission and City Council, is hereby amended as follows: Change the land use designation as shown on the attached map from OFC – Office, BP – Business Park, RRR – Railroad and Right-of-Way to MX Mixed Use. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk City Council Meeting of April 17, 2017 (Item No. 8a) Page 33 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD SUMMARY RESOLUTION NO.17-____ A RESOLUTION APPROVING AN AMENDMENT TO THE 2030 COMPREHENSIVE PLAN FOR THE CITY OF ST. LOUIS PARK UNDER MINNESOTA STATUTES 462.351 TO 462.364 SOUTHEAST QUADRANT HIGHWAY 7 AND WOODDALE AVENUE AND THE NORTHEAST CORNER OF WEST 36TH STREET AND WOODDALE AVENUE This resolution states that the land use designation of described location shall be changed from OFC – Office, BP – Business Park, RRR – Railroad and Right-of-Way to MX – Mixed Use. Adopted by the City Council April 17, 2017 Contingent upon approval of the Metropolitan Council Jeffrey W. Jacobs /s/ Mayor A copy of the full text of this resolution is available for inspection with the City Clerk. Published in St. Louis Park Sailor: April 27, 2017 City Council Meeting of April 17, 2017 (Item No. 8a) Page 34 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD ORDINANCE NO.____-17 ORDINANCE AMENDING THE ST. LOUIS PARK CITY CODE RELATING TO ZONING BY CREATING SECTION 36-268-PUD 9 AS A PLANNED UNIT DEVELOPMENT ZONING DISTRICT FOR THE PROPERTY LOCATED AT THE SOUTHEAST QUADRANT OF HIGHWAY 7 AND WOODDALE AVE AND THE NORTHEAST CORNER OF WEST 36TH STREET AND WOODDALE AVENUE THE CITY OF ST. LOUIS PARK DOES ORDAIN: Findings Sec. 1. The City Council has considered the advice and recommendation of the Planning Commission (Case No. 07-04-CP, 17-05-S, 17-06-PUD, 17-07-VAR) for amending the Zoning Ordinance to create a new Planned Unit Development (PUD) Zoning District. Sec. 2. The Comprehensive Plan designates this property as Mixed Use. Sec. 3. The Zoning Map shall be amended by reclassifying the following described lands from I-P Industrial Park to PUD 9: Lot 1, Block 1, PLACE, Hennepin County, Minnesota Lot 1, Block 2, PLACE, Hennepin County, Minnesota Sec. 4. The Zoning Map shall be amended by reclassifying the following described lands from C-2 General Commercial to PUD 9: Lot 1, Block 3, PLACE, Hennepin County, Minnesota Sec. 5. The St. Louis Park Ordinance Code, Section 36-268 is hereby amended to add the following Planned Unit Development Zoning District: Section 36-268-PUD 9. (a) Development Plan The site shall be developed, used and maintained in conformance with the following Final PUD signed Official Exhibits: 1.PUD Exhibit 2. G001 – Cover Sheet 3. G002 – Legend 4. G003 – General Notes 5. C001 – Existing Conditions and Removals 6. C003 – Tree Removals and Preservation Plan 7. C101 – Site Plan – Overall 8. C102 – Site Plan Northwest 9. C103 – Site Plan Northeast City Council Meeting of April 17, 2017 (Item No. 8a) Page 35 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD 10. C101 – Site Plan South 11. C201 – Temporary Erosion Control Plan 12. C301 – Grading and Drainage Plan – Overall 13. C401 – Sanitary Sewer and Watermain 14. C402 – Storm Sewer Plan 15. C801 – Site Details 16. C802 – Site Details 17. C901 – City Std Utility Plates 18. C902 – City Std Utility Plates 19. C903 – City Std Utility Plates 20. C904 – City Std Erosion Control Plates 21. C1001 – MNDOT Std Ped Curb Ramp Details 22. C1002 – MNDOT Std Ped Curb Ramp Details 23. L101 – Planting Plan – Overall 24. L102 – Planting Plan – Northwest 25. L103 – Planting Plan – Northeast 26. L104 – Planting Plan – South 27. L801 – Planting Details 28. V101 – Preliminary Plat 29. V102 – Preliminary Plat 30. V103 – Preliminary Plat 31. E101 – Electrical Site Plan – Overall 32. S001 – Site Plan 33. A101 – North Building Floor Plans 34. A102 – North Building Floor Plans 35. A103 – North Building Floor Plans 36. A104 – North Building Floor Plans 37. A105 – North Building Floor Plans 38. A106 – North Building Elevations 39. A107 – North Building Illustrative Elevations 40. A201 – South Building Hotel & Residential Floor Plans 41. A202 – South Building Hotel & Residential Floor Plans 42. A203 – South Building Hotel & Residential Floor Plans 43. A204 – South Building Hotel & Residential Floor Plans 44. A205 – South Building Hotel & Residential Floor Plans 45. A206 – South Building Hotel & Residential Floor Plans 46. A207 – South Building Hotel & Residential Floor Plans 47. A208 – South Building Hotel & Residential Floor Plans 48. A209 – South Building Hotel & Residential Floor Plans 49. A210 – South Building Elevations 50. A211 – Hotel Elevations 51. A212 – South Building Illustrative Elevations 52. A301 – E-Generation Floor Plans 53. A302 – E-Generation Roof Plan 54. A303 – E-Generation Elevations 55. A401 – 3D View 56. A501 – Illustrative Sections 57. A502 – Sections 58.PLACE – Envelope Proposals City Council Meeting of April 17, 2017 (Item No. 8a) Page 36 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD 59.PLACE – Sustainability Proposals 60.PLACE – Proof of Parking 61.PLACE – Lighting Proposals 62.PLACE – Parking Requirements 63.PLACE – Mobility Plan (Travel Demand Management Plan) The site shall also conform to the following requirements: 1)The property shall be divided into four zones, as indicated on PUD Exhibit of the Official Exhibits. The zones shall be established by dividing the site into a northwest site, a northeast site, a southwest site, and a southeast site. The northwest site shall be called “Site A – E-Gen”, the northeast site shall be called “Site B – North” the southwest site shall be called “Site C – Hotel” and the southeast site shall be called “Site D – South”. 2)Parking will be provided off-street in a surface lot, on-street, in structured parking, and within the public plaza. The property shall be developed with 299 residential units, including 99 live/work units, a 110 room hotel, a minimum of 35,000 square feet of ground floor commercial space, 0.88 acres of urban forest, an e-generation energy facility, and a greenhouse. Parking will be provided off-street in a surface lot, on-street parallel parking, and structured parking. A total of four-hundred-forty-seven (447) parking spaces will be provided: 251 spaces for residential units or 0.83 spaces per dwelling unit, 110 spaces for the hotel or 1.0 space per hotel room, 76 spaces for non-residential uses and 10 spaces for shared cars. An additional 55 spaces are required as a proof of parking as indicated on Sheet 60 of the Official Exhibits. Parking requirements are provided based on Sheet 62 of the Official Exhibits. 3)The maximum height for Site A – E-Gen shall not exceed 33 feet for the building, and 40 feet for the flute. The maximum building height for Site B – North shall not exceed 61 feet and five stories and 78 feet for the helical wind turbine. The maximum height for Site C – Hotel shall not exceed 76 feet and six stories and the maximum height for Site D – South shall not exceed 79 feet and six stories. 4)The development site shall include a minimum of 12 percent designed outdoor recreation area based on private developable land area. 5)The development shall incorporate a Travel Demand Management (TDM) plan including: City Council Meeting of April 17, 2017 (Item No. 8a) Page 37 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD a.The development shall offer car-free incentives for a minimum of 90 dwelling units. b.The development shall provide 10 cars available as a car share. c.The development shall provide a local shuttle until opening day of the Southwest Light Rail Green Line Wooddale Station. d. A transportation concierge program shall be maintained. e.The development shall provide car-free perks for 90 households until the site conforms to the city’s off-street parking requirements. f.The TDM plan shall be reported to the city annually for a duration of three (3) years. (b) Site A – E-Gen 1)Permitted with Conditions a.Anaerobic digester. Anaerobic digesters shall be permitted only as part of a larger development which contains at least one other principal use, and where electricity and bio-gas produced by the digester is used primarily by the larger development. i.Organic material, as defined in the Zoning Code, is the only input allowed. ii.No more than 3,000 tons of organic material shall be processed per year. iii.The digester system, associated equipment and operations must occur completely within a negative-pressure building. iv.Organic material shall be deposited from the delivery vehicle directly into an enclosed container integrated with the digester system. v.Sorting of material must occur in an enclosed container integrated with the digester system. vi.Odor controlling devices shall be used to prevent odors from being detectable outside of the building containing the digester system. vii.Flaring of bio-gas is only allowed to burn excess gas and shall not be visible from off-site. viii.No outdoor storage is allowed. ix. Retail distribution of compressed natural gas is not allowed. x.All necessary permits relating to items such as: emissions, solid waste processing, energy production, industrial waste water, and storm water must be obtained from the appropriate agencies. xi.All necessary contracts or agreements with material providers and utility companies must be submitted to the City prior to the issuance of a building permit. 2)Accessory Uses a.Greenhouse. City Council Meeting of April 17, 2017 (Item No. 8a) Page 38 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD b. Parking lots. c.Outdoor seating, with the following conditions: i.No speakers or other electronic devices which emit sound are permitted outside of the principal structure if the use is located within 500 feet of a residential use. ii.Hours of operation shall be limited to 7:00 a.m. to 10:00 p.m. if located within 500 feet of a residential use. d. Outdoor uses and outdoor storage are prohibited. e. Solar panels i.Rooftop or building mounted systems 1.Roof or building mounted solar systems may exceed the maximum allowed height in the PUD zoning district by 3 feet. ii.Ground or accessory structure mounted solar systems 1.The height of a ground or accessory structure mounted solar system, measured when oriented at maximum design tilt, shall not exceed 20 feet. (c) Site B – North 1)Permitted with Conditions: a.Multiple-family dwellings. Uses associated with the multiple-family dwellings, including, but not limited to the residential office, fitness facility, mail room, assembly rooms or general amenity space. b.Live-work Type I. i.All material or equipment shall be stored within an enclosed structure. ii.Operation of the home occupation is not apparent from the public right-of-way. iii.The activity does not involve warehousing, distribution or retail sales of merchandise produced off the site. iv.No person is employed at the residence who does not legally reside in the home except that a licensed group family day care facility may have one outside employee. v.No light or vibration originating from the business operation is discernible at the property line. vi.Only equipment, machinery and materials which are normally found in the home are used in the conduct of the home occupation. vii.No more than one non-illuminated wall sign limited to two square feet in area is used to identify the home occupation. viii.Space within the dwelling devoted to the home occupation does not exceed one room or forty-five (45) percent of the floor area, whichever is greater. ix.No portion of the home occupation is permitted within any attached or detached accessory building. x.The structure housing the home occupation conforms to the building code; and in the case where the home occupation is day care or if there are any customers or students, the home occupation has received a certificate of occupancy. City Council Meeting of April 17, 2017 (Item No. 8a) Page 39 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD c.Commercial uses. Commercial uses are only permitted on the first floor, and are limited to the following: coffee shops, office, private entertainment (indoor), retail shops, service, showrooms and studios. i.All parking requirements must be met for each use per Sheet 62 of the Official Exhibits. ii.Hours of operation for commercial uses shall be limited to 6 a.m. to 12 a.m. iii.Restaurants are prohibited. iv. In vehicle sales is prohibited. d.Civic and institutional uses. Civic and institutional uses are limited to the following: education/academic, library, museums/art galleries, indoor public parks/open space, police service substations, post office customer service facilities, public studios and performance theaters. 2)Accessory Uses: a.Incidental repair or processing which is necessary to conduct a permitted use and not to exceed ten percent of the gross floor area of the associated permitted use. b.Home occupations complying with all of the conditions in the R-C district. c. Catering, if accessory to food service, delicatessen or retail bakery. d.Gardens. e.Parking lots. f.Outdoor seating, with the following conditions: i.No speakers or other electronic devices which emit sound are permitted outside of the principal structure if the use is located within 500 feet of a residential use. ii.Hours of operation shall be limited to 7:00 a.m. to 10:00 p.m. if located within 500 feet of a residential use. g.No outdoor uses or storage allowed. h.Solar panels i.Roof or building mounted solar systems may exceed the maximum allowed height in the PUD zoning district by 3 feet. 3) Wind Energy Conversion Systems (WECS), with the following conditions: a.Wind turbines shall be of the helical-type. b.Helical wind turbines shall meet the following design requirements i.One WECS shall be allowed per lot. ii.The WECS unit shall not exceed 17 feet in height, and shall not exceed 79 feet overall, including the building height when attached to the roof of a building. iii.The fall zone shall be completely within the property lines of the lot within which the WECS is located. iv.Minimize visual impact. WECS design and location shall minimize visual impact. v.Color and finish. All WECS shall be white, grey, black or another non-obtrusive color. Blades may be black in order to facilitate deicing. Finishes shall be matt or non-reflective. vi.Tower lighting. WECS shall not be artificially lighted, except as specified herein and to the extent required by the FAA or other City Council Meeting of April 17, 2017 (Item No. 8a) Page 40 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD federal or state law or regulation that preempts local regulations. vii.Signs and displays. The use of any portion of a WECS for displaying flags and signs, other than warning or equipment information signs, is prohibited. viii.Associated equipment. Ground equipment associated with a WECS shall be housed in a structure. Structures housing equipment shall meet the architectural design standards of the Zoning Ordinance. Control wiring and power-lines shall be wireless or underground. ix.Braking system required. All WECS shall have an automatic braking, governing or feathering system to prevent uncontrolled rotation, over speeding and excessive pressure on the structure, rotor blades and turbine components. x.Design height. The applicant shall provide evidence that the proposed height of the WECS does not exceed the height recommended by the manufacturer or distributor of the system. xi.Interconnection agreement. The applicant shall provide a copy of the utility notification requirements for interconnection, unless the applicant intends, and so states on the application, that the system will not be connected to the electricity grid. xii.Technology standards. WECS must meet the minimum standards of a WECS certification program recognized by the American Wind Energy Association, such as AWEA’s Small Wind Turbine Performance and Safety Standard, the Emerging Technologies program of the California Energy Commission, or other 3rd party standards acceptable to the City. xiii.Noise. Audible sound due to wind energy system operations shall comply with the standards governing noise contained in the City of St. Louis Park Code of Ordinances. xiv.If the WECS remains nonfunctional or inoperative for a continuous period of one year, the system shall be deemed abandoned and shall constitute a public nuisance. The owner shall remove the abandoned system at their expense after a demolition permit has been obtained. Removal includes the entire structure including foundations to below natural grade and transmission equipment. (d) Site C – Hotel 1)Permitted: a.Hotel. Uses associated with the hotel, including but not limited to hotel office, fitness facility, pool, parking, mail room, assembly rooms or general amenity space. 2)Permitted with Conditions: a.Commercial uses. Commercial uses are only permitted on the first floor, and are limited to the following: restaurants, coffee shops, office, private entertainment (indoor), retail shops, service, showrooms and studios. i.All parking requirements must be met for each use per Sheet 62 of the Official Exhibits. City Council Meeting of April 17, 2017 (Item No. 8a) Page 41 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD ii.Hours of operation for commercial uses shall be limited to 6 a.m. to 12 a.m. iii.In vehicle sales is prohibited. b.Civic and institutional uses. Civic and institutional uses are limited to the following: education/academic, library, museums/art galleries, indoor public parks/open space, police service substations, post office customer service facilities, public studios and performance theaters. 3)Accessory Uses: a.Incidental repair or processing which is necessary to conduct a permitted use and not to exceed ten percent of the gross floor area of the associated permitted use. b.Catering, if accessory to food service, delicatessen or retail bakery. c.Parking lots. d.Outdoor seating, with the following conditions: i.No speakers or other electronic devices which emit sound are permitted outside of the principal structure if the use is located within 500 feet of a residential use. ii.Hours of operation shall be limited to 7:00 a.m. to 10:00 p.m. if located within 500 feet of a residential use. e.No outdoor uses or storage allowed. f.Solar panels i.Roof or building mounted solar systems may exceed the maximum allowed height in the PUD zoning district by 3 feet. (e) Site D – South 1)Permitted with Conditions: a.Multiple-family dwellings. Uses associated with the multiple-family dwellings, including, but not limited to the residential office, fitness facility, mail room, assembly rooms or general amenity space. b.Live-work Type I. i.All material or equipment shall be stored within an enclosed structure. ii.Operation of the home occupation is not apparent from the public right-of-way. iii.The activity does not involve warehousing, distribution or retail sales of merchandise produced off the site. iv.No person is employed at the residence who does not legally reside in the home except that a licensed group family day care facility may have one outside employee. v.No light or vibration originating from the business operation is discernible at the property line. vi.Only equipment, machinery and materials which are normally found in the home are used in the conduct of the home occupation. vii.No more than one non-illuminated wall sign limited to two square feet in area is used to identify the home occupation. viii.Space within the dwelling devoted to the home occupation does not exceed one room or forty-five (45) percent of the floor area, whichever is greater. City Council Meeting of April 17, 2017 (Item No. 8a) Page 42 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD ix.No portion of the home occupation is permitted within any attached or detached accessory building. x.The structure housing the home occupation conforms to the building code; and in the case where the home occupation is day care or if there are any customers or students, the home occupation has received a certificate of occupancy. c. Live-work Type II. i.Live-work uses as defined by Sec. 36-142 of city code are permitted on the first floor. ii.A Registration of Land Use (RLU) shall be approved by the city when there is a change in tenant. d.Commercial uses. Commercial uses are only permitted on the first and second floors, and are limited to the following: coffee shops, office, private entertainment (indoor), retail shops, service, showrooms and studios. i.All parking requirements must be met for each use per Sheet 62 of the Official Exhibits. ii.Hours of operation for commercial uses shall be limited to 6 a.m. to 12 a.m. iii.Restaurants are prohibited. iv. In vehicle sales is prohibited. e.Civic and institutional uses. Civic and institutional uses are limited to the following: education/academic, library, museums/art galleries, indoor public parks/open space, police service substations, post office customer service facilities, public studios and performance theaters. 2)Accessory Uses: a.Incidental repair or processing which is necessary to conduct a permitted use and not to exceed ten percent of the gross floor area of the associated permitted use. b.Home occupations complying with all of the conditions in the R-C district. c. Catering, if accessory to food service, delicatessen or retail bakery. d.Gardens. e.Parking lots. f.Outdoor seating, with the following conditions: i.No speakers or other electronic devices which emit sound are permitted outside of the principal structure if the use is located within 500 feet of a residential use. ii.Hours of operation shall be limited to 7:00 a.m. to 10:00 p.m. if located within 500 feet of a residential use. g.No outdoor uses or storage allowed. h.Solar panels i.Roof or building mounted solar systems may exceed the maximum allowed height in the PUD zoning district by 3 feet. (d) Special Performance Standards City Council Meeting of April 17, 2017 (Item No. 8a) Page 43 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD (1)All general zoning requirements not specifically addressed in this ordinance shall be met, including but not limited to: outdoor lighting, architectural design, landscaping, parking and screening requirements. (2)The site is exempt from the shadowing requirements specified in Section 36- 366(b)(1)g of the zoning ordinance. (3)Each commercial, civic or institutional tenant space on the ground floor facing West 36th Street shall have a direct and primary access to and from the 36th Street (south) building façade and the access shall remain open during business hours. (4)All trash, garbage, waste materials, trash containers, and recycling containers shall be kept in the manner required by this Code. All trash handling and loading areas shall be screened from view within a waste enclosure. (5)Signage shall be allowed in conformance with the approved redevelopment plan or final PUD site plan and development agreement in accordance with the following conditions: a.Pylon signs are prohibited; b.Freestanding monument signs shall utilize the same exterior materials as the principal buildings and shall not interfere with pedestrian, bicycle or automobile circulation and visibility; c.Maximum allowable number, sizes, heights and yards for signs shall be regulated by section 36-362, MX requirements. d.Wall signs of non-residential uses shall only be placed on the ground floor and exterior walls of the occupied tenant lease space, and/or a monument sign. e.Wall signs shall not be included in calculating the aggregate sign area on the lot if they meet the following outlined conditions: 1.Non-residential wall signs permitted by this section that do not exceed seven percent of the exterior wall area of the ground floor tenant lease space. 2.The sign is located on the exterior wall of the ground floor tenant lease space from which the seven percent sign area was derived. 3. No individual wall sign shall exceed 100 square feet in area. (6)Façade. a.Fibrous cement, high performance brick veneer with rain screen cladding systems, and vertically integrated photovoltaic panels shall be considered Class I Materials. b.The following façade design guidelines shall be applicable to all ground floor non-residential street-facing facades and all ground floor non- residential facades on the west façade of Site D South, including live/work type II units: 1.The minimum ground floor transparency shall be 60% at the pedestrian level. 2.No more than 10% of total window and door area shall be glass block, mirrored, spandrel, frosted or other opaque glass, finishes or material including window painting and signs. The remaining 90% City Council Meeting of April 17, 2017 (Item No. 8a) Page 44 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD of window and door area shall be clear or slightly tinted glass, allowing views into and out of the interior. 3.Active permitted uses, not including storage areas or utility closets, shall be maintained for a minimum depth of 15 feet. 4.Visibility into the space shall be maintained for a minimum depth of ten feet. This requirement shall not prohibit the display of merchandise. (7)Awnings. a.Awnings must be constructed of heavy canvas fabric, metal and/or glass. Plastic and vinyl awnings are prohibited. b.Backlit awnings are prohibited. Sec. 6. The contents of Planning Case File 07-04-CP, 17-05-S, 17-06-PUD, 17-07-VAR are hereby entered into and made part of the public hearing record and the record of decision for this case. Sec. 7. This Ordinance shall take effect fifteen days after its publication. Public Hearing March 15, 2017 First Reading April 17, 2017 Second Reading May 1, 2017 Date of Publication May 11, 2017 Date Ordinance takes effect May 26, 2017 Reviewed for Administration Adopted by the City Council May 1, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Approved as to Form and Execution: Melissa Kennedy, City Clerk Soren Mattick, City Attorney City Council Meeting of April 17, 2017 (Item No. 8a) Page 45 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD D R A F T UNOFFICIAL MINUTES PLANNING COMMISSION ST. LOUIS PARK, MINNESOTA MARCH 15, 2017 – 6:00 p.m. COUNCIL CHAMBERS MEMBERS PRESENT: Lynne Carper, Claudia Johnston-Madison, Torrey Kanne, Lisa Peilen, Joe Tatalovich, Ethan Rickert (youth member) MEMBERS ABSENT: Richard Person, Carl Robertson STAFF PRESENT: Jennifer Monson, Jack Sullivan, Sean Walther 1.Call to Order – Roll Call Chair Peilen called the meeting to order. 2. Approval of Minutes of February 1, 2017 Commissioner Johnston-Madison made a motion to approve the minutes of February 1, 2017. Commissioner Tatalovich seconded the motion, and the motion passed on a vote of 5-0. 3.Public Hearings A.PLACE Comprehensive Plan Map Amendment; Preliminary and Final PUD; Preliminary and Final Plat Location: 5605 W. 36th Street Applicant: PLACE E-generation One, LLC Case No: 17-04-CP, 17-05-S, 17-06-PUD, 17-07-VAR Jennifer Monson, Planner, presented the staff report. Ms. Monson provided the development summary and site information. She said for the last 20 years the city has anticipated the site to redevelop and has actively purchased properties around the site for that redevelopment. The expectation is that it would redevelop into a transit oriented mixed use development. Ms. Monson spoke about the land use and transportation studies in the area which identify the site as future transit oriented development. Ms. Monson provided background on PLACE’s proposal which began with discussions in November, 2013. She reviewed the public process for PLACE which has occurred since that time. The applicant requests a change to the future land use designation of the site to MX Mixed Use to create a pedestrian scale mixed use building with retail service or other commercial uses on the ground floor, and residential or office uses on upper floors. Ms. Monson stated that MX Mixed Use is intended to facilitate a diversity of uses in certain areas of the City Council Meeting of April 17, 2017 (Item No. 8a) Page 46 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD community. She reviewed the goals and vision of the Mixed Use designation in the Comprehensive Plan and the availability of infrastructure which staff uses to analyze requests. Ms. Monson spoke about the Environmental Assessment Worksheet (EAW) which has been completed. The comment period for the EAW ends on April 5, 2017. Ms. Monson discussed city improvements to be made to the transportation network related to SWLRT and the PLACE development. Ms. Monson provided staff analysis of the request for Preliminary and Final Plat which would combine nine properties in the northeast quadrant of Wooddale Ave. and W. 36th Street intersection. Ms. Monson discussed the PUD request, including the helical wind turbine to be located on the property. She discussed the robust mobility plan which includes a bike share and car share. She discussed parking, building materials, landscaping, sustainability and energy efficiency. Ms. Monson stated on Feb. 23, 2017 PLACE held its 8th neighborhood meeting with 60 people in attendance. Concerns included increased traffic, inadequate parking, density, hotel, number of affordable units and increase of neighborhood taxes. Support included the density near light rail, dedication to car-free living, building design, inclusion of affordable housing and the community offered by the project such as the woonerf and urban forest. Chris Velasco, applicant, PLACE E-generation One, stated that PLACE exists for the purpose of building healthy communities for all and specializes in creating communities that are for the arts and feature a high degree of sustainable design. He provided examples of live/work spaces in the project. Mr. Velasco spoke about Marriott’s interest in the proposed hotel. This would bundle housing and jobs together. He said three independent market studies completed for hotel at the site were positive. He spoke about PLACE and Marriott’s relationship with Park Nicollet Health Services. Patients and families could stay one-half mile from Park Nicollet clinics and the hospital. Mr. Velasco explained the sustainability features of the project. He discussed benefits of the development to the St. Louis Park community. Commissioner Carper asked how residents would commute until 2021 when SWLRT is projected to begin. Ms. Monson responded that the city is requiring the developer to offer a shuttle for the first three years or until SWLRT is complete. The hotel will also be providing a shuttle to and from the airport. Commissioner Carper and Ms. Monson discussed standards, height, pole, location, sound and code regarding the proposed helical turbine. City Council Meeting of April 17, 2017 (Item No. 8a) Page 47 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Mr. Velasco provided dimensions for the proposed turbine. Sean Walther, Planning and Zoning Supervisor, noted that code would allow a helical style turbine, however the ordinance contemplated a rotary style. The main modification being requested through PUD is to allow a rooftop mounted turbine rather than a ground mounted turbine. He said staff believes that would also reduce the overall height of the turbine that is required. Commissioner Rickert asked if apartments would be sound proofed for musicians. Mr. Velasco responded that is very difficult to do for apartment units. Four soundproof rooms will be built, however. Commissioner Rickert asked who would have access to the greenhouse area. Mr. Velasco said anyone in the community would have access to the greenhouse area, all year long. Commissioner Kanne asked what would happen if the hotel fails. Mr. Velasco responded he thinks the relationship PLACE has with Park Nicollet and Methodist Hospital would prevent that from happening. Their use of the hotel will assure high occupancy. He said the three feasibility studies done on a proposed hotel do not indicate failure. Commissioner Kanne spoke about the email sent by resident Janet Zastrow, 3700 Wooddale Ave. S., which referenced the Schmidt Artist Lofts in St. Paul as a development community for artists. Commissioner Kanne said she understands one of the problems with that development is that artists are resisting rules and regulations. Mr. Velasco stated he has a great deal of experience in development for the arts and live/work units. He spoke about very specific rules called house privileges and commitments which are shared with applicants. Chair Peilen asked how traffic would proceed south on Wooddale Ave. Jack Sullivan, staff engineer reviewing PLACE, and staff liaison for SWLRT, said a small percentage of drivers will want to make a left turn. He said driver behavior and habits will transition over time for right turn movements at that location. Vehicle movements will use Hwy. 100 and Hwy. 7 access locations. He said he anticipates very little traffic heading to or from the Sorensen neighborhood. He added that the removal of the left turn out would have happened with or without the PLACE development. Chair Peilen said the number of required parking spots has been reduced but less car-use is an experiment. She asked if that doesn’t work is there a way to get more parking spaces. Ms. Monson said the developer has been required to provide a Proof of Parking document which shows they could provide another 55 parking spaces. There are also other opportunities where spaces could be leased in the neighborhood. City Council Meeting of April 17, 2017 (Item No. 8a) Page 48 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Chair Peilen said two-thirds of the units are affordable housing. She asked if PLACE would have the budget to maintain the building with those lower rents. Mr. Velasco said developers must contribute heavily to capitalized operating and replacement reserves upfront and those are deemed sufficient for maintenance and improvements. Chair Peilen commented that her biggest concern is that so much of the project is predicated on light rail occurring. Commissioner Johnston-Madison read from Walker Parking consultant conclusion on page eight. She said she is concerned about the lag time between light rail operation and the time people start moving into PLACE. She said she is concerned during those three years there will be parking and traffic in the neighborhood. She said she’s concerned that this is an experiment. She asked about the Level of Service summary. Mr. Sullivan stated that the Level of Service designation is per intersection. Level of Service D or better is what the Council and Engineering department have historically used as acceptable. Commissioner Johnston-Madison said the city needs to have developments that don’t perpetuate Level of Service D throughout this entire quadrant. She said the City Council has heard from many people that they are unhappy with this and it doesn’t seem the issue is being listened to. Commissioner Johnston-Madison asked about incentives for not driving. Mr. Velasco said the car-free perks include a $70/month stipend to not have a car. Commissioner Johnston-Madison spoke about poor bus service prior to light rail. Mr. Velasco spoke about discussions held with Metro Transit about improved levels of bus service prior to light rail operation. Commissioner Johnston-Madison spoke about a January 2016 neighborhood meeting where PLACE spoke about additional organic waste to be shipped in for the generator. She asked why this has been dropped from plans. Mr. Velasco said PLACE had been discussing working with the City’s organic program for this but there was a mis-match in sorting. He said it seems the best thing to do was to scale down the E-generation facility. Spent grain will also be provided by Steel Toe Brewery to bolster PLACE’s local collection. Commissioner Carper asked about shading. Mr. Walther responded that there are exceptions to shading when the shadow occurs within the PUD. On this site the northwest corner of 36th & Yosemite would be impacted. The west wall of the existing one-story commercial building would be impacted. City Council Meeting of April 17, 2017 (Item No. 8a) Page 49 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Chair Peilen opened the public hearing. Roger Onken, 3600 Wooddale Ave. S. #212, stated he loves the philosophy and design. He doesn’t like the height of the building. He said he thinks six stories for St. Louis Park is too high. Reducing the height would reduce the number of units and parking spaces. He doesn’t feel assured that enough people would choose to go car-free at the development, particularly with the delay of light rail. He said he doesn’t like the inadequate tree and shrub count. He said the employees and customers related to live/work units would require more parking. He said he is concerned about the impact of a hotel of that size on the neighborhood. He said he felt there is a lot of unknown with the proposal. He stated he is concerned about his building’s driveway exit to get on to Highway 7. There will be a better sense of the perfect scenario with light rail in 2021. He said he thought the turbine would be intrusive with the height of the building. He said he didn’t like the proposed setback on 36th and Wooddale. Sheila Asato, Monkey Bridge Arts, 6801 W. Lake St., said PLACE sounds ideal for studio space and light rail. She asked if units are rental or for sale. James McDonough, 2840 Cavell, a 42-year resident, said he is heavily involved in the arts in St. Louis Park. He said he is fully supportive of the project and understands creative visioning involves a risk. He said that is the way with all progress and development. Mr. McDonough said his hope is that PLACE’s rental apartment development will be his next destination. He said he encourages the Commission’s strong and full support for the project. Russell Griesner, 3700 Wooddale Ave S. #14, commented that as a creative he couldn’t be more excited about PLACE. He said it is exactly what St. Louis Park needs and it is the reason he was attracted to this community. He said he doesn’t think it is an experiment with the traffic. He said we live in a time where car-free desire is here, now. He stated members of his family would love to have living space which is car-free. Alonso Ramos, 3738 Dakota Ave. S., stated that he just bought his first house and is new in the neighborhood. He said he is concerned about decrease of property values related to affordable. He said the project minimizes winter and car concerns. He said he used to live in affordable housing in Minnesota. He spoke about problems and disrespect he experienced. He said he is concerned about security and safety with affordable housing with light rail. He said the Lake and Hiawatha rail station is scary. He spoke about a study which shows higher housing property crimes in areas with affordable housing. He said he isn’t opposed to the project but the location is the wrong location. Mr. Ramos distributed copies of his notes. Danielle Griesner, 3700 Wooddale Ave. S., #14, stated her background is public health and she works to better the health of families and communities to make the healthy choice the easy choice. She said is excited about walkability and sustainability which is why her family moved to St. Louis Park and she is in full support of the project. J.W. Starrett, 5825 Goodrich Ave. S., said his concern is traffic and parking. He said it is a very exciting project for the community. He said he feels like they’ve been backed into this. The expectations and innovation are good in the beginning. He said the expectations City Council Meeting of April 17, 2017 (Item No. 8a) Page 50 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD have all moved backwards to a point where an adequate level is met for right now. He said he is excited about the future but we aren’t ready for 2021. He said he doesn’t think the traffic numbers are giving the right picture and he recommends that the Planning Commission conduct another traffic study. It will make a big difference as to why this works. Mr. Starrett said he has concerns about all the new rental units in the city which are at full occupancy which affects traffic and parking. He said Fair Housing will make sure everyone gets in and the management won’t be able to force everyone to be an artist or to follow the rules. He said the city needs to be realistic about the numbers and that we haven’t backed ourselves into a project. Chair Peilen acknowledged the receipt of an email dated March 14, 2017, from Janet Zastrow, 3700 Wooddale Ave. S., #5, expressing concerns about the project. Also received is a letter dated March 13, 2017, from Joel A. Hilgendorf, attorney representing Standal Properties, objecting to the request for variance to the shading requirement. Chair Peilen closed the public hearing as no one else was present wishing to speak. Chair Peilen stated that the city has very stringent rental regulations and she is assured that PLACE will be required to do background checks on all rental applicants. She said there is a very strong inspections and complaint process in the city as well as very strong rental housing laws. Mr. Walther said the live/work spaces for employee parking was factored in to studies. Peak times are studied as largest demand in parking studies. Peak time for live/work spaces is daytime. Peak time for hotel is around 9 p.m. Parking is not public; it is for commercial uses, for residents and for hotel guests on the site. Mr. Walther spoke about hotel experience in the city. The city’s parking requirement for hotels is recognized by staff as being high and is routinely reviewed for reductions. Hotel market professionals say .8 or 1 space per room is the going demand for parking for most of the hotel chains. The city’s requirement is 1.5 spaces which covered other mixed uses on a site. He said PLACE’s hotel is a limited service hotel and restaurant parking is calculated separately. Mr. Walther said all units are rental apartments and there are no for sale units included. Mr. Walther said if the turbine is located on the E-generation building it would be closer to the range of 64-66 ft. tall which is not out of line with the height of the buildings which are proposed for the project. Ms. Monson said the 10 feet which was mentioned as setback is the amount of land that PLACE is dedicating to the city for right-of-way, it’s not the setback from the curb line. The setback on Wooddale is 15 feet and on 36th Street the setback is significantly more than 26 feet. Ms. Monson stated the way the PUD is written all live/work type 1 cannot have any outside employees working there. The maximum number of employees for live/work type 2 is two. Commissioner Johnston-Madison asked about car sharing. City Council Meeting of April 17, 2017 (Item No. 8a) Page 51 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Ms. Monson said PLACE is looking at using HourCar. If for some reason there isn’t a company offering those services the developer could purchase ten cars and those could serve as car shares for the development. Ten parking spaces have been included in the requirements. Mr. Walther reviewed the Environmental Action Worksheet (EAW) process and timeline. Commissioner Carper asked for heights of the area residential developments. Ms. Monson said the proposed Elmwood development on the east side of 36th Street is 77 feet tall (6 stories). Hoigaard Village to the north is approximately 67 ft tall (5 stories). Tower Light directly south is 5 stories tall. Buildings kitty corner to PLACE are approximately 3 ½ stories tall. Ms. Monson commented that the city did a streetscape plan in 2006 looking at landscaping and setbacks on 36th St. as well as building setbacks and how the road would function with the lane width. The dedication required on 36th St. is being required to meet that plan. Chair Peilen said the project is so bold and progressive but her biggest concern are challenges if light rail doesn’t happen. The success of project seems completely linked to light rail. Mr. Velasco replied that PLACE has been working closely with SWLRT and they have said they are moving forward and have given no indication PLACE has anything to worry about in that regard. He added that if something should go wrong and there is no light rail, a good transit oriented development can still be done. He said the nature of car ownership and mobility is changing dramatically and PLACE will be able to take advantage of new technologies coming. Commissioner Johnston-Madison said she has always liked the project and thinks it’s a great experiment. But all the numbers that make the project work on paper are right up to the edge on everything. She said she likes the north side of the project. But there are too many questions about hotel and wind turbine. She said she doesn’t think the project is ready. She said we can’t afford as a city to approve a project when the viability relates to unanswered questions. She said she can’t recommend approval for the plat and PUD. Commissioner Carper said he was concerned prior to the meeting but his issues have been satisfactorily cleared up. Regarding concern of concentration of affordable housing, he said developers have been encouraged to provide affordable housing through TIF. He commented that affordable housing is scarce in the city. He said he is uncomfortable with a turbine so enormous in the area but there are other existing large structures within the city. Regarding light rail, he said PLACE could be delayed three years at great expense and three years of an innovative project will have been lost. He said all developments come with a risk. Commissioner Kanne said her biggest worry has always been about traffic. She lives in the Elmwood neighborhood and has children who ride bikes in the area. She said she has watched all the new development happen in Elmwood and said the intersection is a City Council Meeting of April 17, 2017 (Item No. 8a) Page 52 Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD nightmare. She added that she is proud to live in a city that would bring such a project to the city and she is in total support of it. Commissioner Tatalovich made a motion to recommend approval of The PLACE Comprehensive Plan Amendment changing the land use designation from OFC –Office, BP – Business Park, RRR – Railroad, and Right-of-way to MX – Mixed Use. Commissioner Carper seconded the motion, and the motion passed on a vote of 5-0. Chair Peilen made a motion to recommend approval of The PLACE Preliminary and Final Plat subject to conditions. Commissioner Carper seconded the motion, and the motion passed on a vote of 4-1 (Johnston-Madison opposed). Commissioner Carper made a motion to recommend approval of The PLACE Preliminary and Final Planned Unit Development subject to conditions. Commissioner Tatalovich seconded the motion, and the motion passed on a vote of 4-1 (Johnston-Madison opposed). Mr. Walther discussed the process and schedule for EAW comments and consideration by City Council. 4. Other Business: None 5. Communications Commissioner Carper asked if the turbine issue might come up for a zoning ordinance amendment. Mr. Walther said the PLACE PUD ordinance would create the rules for that site to allow that particular use. But it does open up a larger policy question for other sites in the community. He suggested that might be discussed in the upcoming revision of the Comprehensive Plan. Mr. Walther spoke about upcoming events including Town Hall for Vision 3.0, Facebook Live for Vision 3.0, and the State of the City. 6. Adjournment The meeting was adjourned at 8:35 p.m. Respectfully submitted, Nancy Sells Recording Secretary WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 V101 PRELIMINARY PLAT V103 SEE SH E E T V102SEE SHEET02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 53 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 V102 PRELIMINARY PLAT 02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT V103 SEE SH E E TV101SEE SHEETCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 54 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 V103 PRELIMINARY PLAT 02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT V101 SEE SH E E T City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 55 That part of Lot 6, Block 23, St. Louis Park; also of Lots 11 to 15 inclusive, Block 23, Lots 19 to 28 inclusive, Block 23, Lot 5, Block 24 and of Block 20 vacated in "Rearrangement Of St. Louis Park" and also of Zarthon Avenue (formerly Earle Street), Walker Street (formerly Broadway), St. Louis Avenue and of alley in Block 23, said Rearrangement and of any vacated portion of said Rearrangement included in the following described lines: Beginning at a point on Northerly right of way line of The Minneapolis & St. Louis Railway Company (which right of way line is parallel with and distant 50 feet at right angles from the center line of the Southbound main track of said Railway Company as there now located), said point being 600 feet Southwesterly from intersection of said right of way with Southwesterly boundary line of Auditor's Subdivision No. 249, Hennepin County, Minnesota; thence Northwesterly at right angles to said right of way 29 feet to a Judicial Landmark established in Torrens Case No. 7986; thence continuing Northwesterly on the last described course a distance of 166.5 feet to a Judicial Landmark established in Torrens Case No. 7986, the point of beginning of Line A to be described, thence Southwesterly on an extension of a line drawn between the last described Judicial Landmark and another Judicial Landmark to an intersection of said extended line with the Westerly line of Lot 6, Block 23, St. Louis Park, the termination of said Line A, the second Judicial Landmark above described being located as follows: Commencing at a point in the Southwesterly boundary line of Auditor's Subdivision No. 249, Hennepin County, Minnesota, said point being distant Northwesterly 29 feet, measured at right angles from the Northerly right of way line of the Minneapolis and St. Louis Railway Company (which right of way line is parallel with and distant 50 feet at right angles from the center line of the South-bound main track of said Railway Company as there now located), thence Northwesterly along said Southwesterly line and the same extended 168.4 feet to the Judicial Landmark being described; thence Southerly along said Westerly line of Lot 6, Block 23, St. Louis Park to the Southwest corner of said Lot; thence Southerly to the most Westerly corner of Block 20 vacated, "Rearrangement of St. Louis Park"; thence Southeasterly along Southwesterly line of said vacated Block 20 to the Northwesterly line of said right of way; thence Northeasterly along said right of way line to point of beginning; Except that part of Lot 6, Block 23, St. Louis Park and that part of Lots 19 to 25 inclusive, Block 23, "Rearrangement of St. Louis Park" which lies Northwesterly of a line drawn from a point in the West line of said Lot 6 distant 35 feet South of the termination of said Line "A" to a point in said Line "A" distant 194 feet Northeasterly of the West line of said Lot 6. Hennepin County, Minnesota. Being Registered land as is evidenced by Certificate of Title No. 1132767. AND Those parts of Government Lots 5, 6, 7 and 8 in Section 16, Township 117 North, Range 21 West of the Fifth Principal Meridian, bounded and described as follows: Beginning at a point on the Northeasterly line of Wood Dale (or Pleasant Avenue), distant 50 feet Northwesterly, measured at right angles, from the center line of the main track of the Minneapolis and St. Louis Railway Company (now the Chicago and North Western Transportation Company), as said main track center line was originally located and established across said Section 16; thence Northeasterly parallel with said original main track center line to a point distant 14 feet Northwesterly, measured at right angles, from the center line of Chicago and North Western Transportation Company (formerly Minneapolis and St. Louis Railway Company) spur track ICC No. 253, as said spur track is now located; thence Southwesterly parallel with said spur track center line to a point distant 30 feet Northwesterly, measured at right angles, from the center line of the main track of the Chicago and North Western Transportation Company (formerly the Minneapolis and St. Louis Railway Company, as said main track is now located; thence Southwesterly parallel with said last described main track center line to a point on the Northeasterly line, or the Southeasterly extension thereof, of said Wood Dale Avenue; thence Northwesterly along said Northeasterly line, or the Southeasterly extension thereof, of Wood Dale Avenue, to the point of beginning. Hennepin County, Minnesota (Abstract Property) AND That part of Government Lot 5, Section 16, Township 117, Range 21, Hennepin County , Minnesota, described as follows: Commencing at a point in the Southwesterly boundary line of Auditor's Subdivision Two Hundred Forty Nine (249) of Government Lot 5, Section 16, Township 117 North, Range 21 West, according to the duly recorded plat thereof and situate in Hennepin County, Minnesota, said point being distant Northwestwardly 29 feet measured at right angles thereto from the Northerly right of way line of the Minneapolis and St. Louis Railway Company (which right of way line is parallel with and distant 50 feet at right angles from the center line of the southbound main track of said railway company as there now located), which point of beginning is marked by a judicial landmark marking the Southeasterly corner of the tract herein described; thence Southwestwardly parallel with said right of way line 600 feet to a judicial landmark marking the Southwesterly corner of the tract herein described; thence Northwestwardly at right angles 166.5 feet to a judicial landmark marking the Northwesterly corner of the tract herein described; thence Northeastwardly at approximately right angles, 600 feet to a point on the Northwesterly extension of the Southwesterly boundary line of said Auditor's Subdivision Two Hundred Forty Nine (249) to said Government Lot 5, which point is marked with a judicial landmark marking the Northeasterly corner of the tract herein described; thence Southeastwardly upon and along said Southwesterly boundary line, as extended, 168.4 feet to the point of beginning. Which lies westerly of the following described line: Commencing at the most northerly corner of the above described property; thence southwesterly along the northwesterly line of said described property a distance of 273.44 feet to the point of beginning of the line to be described; thence southwesterly deflecting to the left 10 degrees 51 minutes 16 seconds, 131.79 feet; thence southerly 122.40 feet along a tangential curve concave to the east having a radius of 120.00 feet and a central angle of 58 degrees 26 minutes 30 seconds; thence southerly, tangent to said curve, 30.99 feet; thence southwesterly 218.40 feet along a tangential curve concave to the west having a radius of 180.00 feet and a central angle of 69 degrees 31 minutes 00 seconds and said line there terminating. Hennepin County, Minnesota. Being Registered land as is evidenced by Certificate of Title No. 1355392. AND That part of Government Lot 5, Section 16, Township 117, Range 21, Hennepin County , Minnesota, described as follows: Commencing at a point in the Southwesterly boundary line of Auditor's Subdivision Two Hundred Forty Nine (249) of Government Lot 5, Section 16, Township 117 North, Range 21 West, according to the duly recorded plat thereof and situate in Hennepin County, Minnesota, said point being distant Northwestwardly 29 feet measured at right angles thereto from the Northerly right of way line of the Minneapolis and St. Louis Railway Company (which right of way line is parallel with and distant 50 feet at right angles from the center line of the southbound main track of said railway company as there now located), which point of beginning is marked by a judicial landmark marking the Southeasterly corner of the tract herein described; thence Southwestwardly parallel with said right of way line 600 feet to a judicial landmark marking the Southwesterly corner of the tract herein described; thence Northwestwardly at right angles 166.5 feet to a judicial landmark marking the Northwesterly corner of the tract herein described; thence Northeastwardly at approximately right angles, 600 feet to a point on the Northwesterly extension of the Southwesterly boundary line of said Auditor's Subdivision Two Hundred Forty Nine (249) to said Government Lot 5, which point is marked with a judicial landmark marking the Northeasterly corner of the tract herein described; thence Southeastwardly upon and along said Southwesterly boundary line, as extended, 168.4 feet to the point of beginning. Except that part which lies westerly of the following described line: Commencing at the most northerly corner of the above described property; thence southwesterly along the northwesterly line of said described property a distance of 273.44 feet to the point of beginning of the line to be described; thence southwesterly deflecting to the left 10 degrees 51 minutes 16 seconds, 131.79 feet; thence southerly 122.40 feet along a tangential curve concave to the east having a radius of 120.00 feet and a central angle of 58 degrees 26 minutes 30 seconds; thence southerly, tangent to said curve, 30.99 feet; thence southwesterly 218.40 feet along a tangential curve concave to the west having a radius of 180.00 feet and a central angle of 69 degrees 31 minutes 00 seconds and said line there terminating. Hennepin County, Minnesota. Being Registered land as is evidenced by Certificate of Title No. 1355391. AND That part of Government Lot 5, Section 16, Township 117, Range 21, bounded and described as follows: Beginning at a point on the Southwesterly line of Auditor's Subdivision 249, distant 50 feet Northwesterly, measured at right angles, from said original main track center line; thence Southwesterly parallel with said center line a distance of 600 feet; thence Northwesterly at right angles to the last described course a distance of 29 feet; thence Northeasterly parallel with said original main track center line a distance of 600 feet; thence Southeasterly at right angles a distance of 29 feet to the point of beginning. Hennepin County, Minnesota. (Abstract Property) Have caused the same to be surveyed and platted as PLACE and does hereby donate and dedicate to the public for public use the public ways and also dedicate the drainage and utility easements as created by this plat. In witness whereof said PLACE, LLC, a Minnesota limited liability company, has caused these presents to be signed by its proper officer this _______ day of ___________________, 20____. PLACE, LLC, a MINNESOTA LIMITED LIABILITY COMPANY XXXXXXXXXXXXXXX, Principal CITY OF ST. LOUIS PARK, MINNESOTA This plat of PLACE was approved and accepted by the City Council of St. Louis Park, Minnesota, at a regular meeting thereof held this ________day of _______________________, 20______, and said plat is in compliance with the provisions of Minnesota Statutes, Section 505.03, Subd. 2. Mayor Clerk I, Daniel J. Roeber, do hereby certify that this plat was prepared by me or under my direct supervision; that I am a duly Licensed Land Surveyor in the State of Minnesota; that this plat is a correct representation of the boundary survey; that all mathematical data and labels are correctly designated on this plat; that all monuments depicted on this plat have been, or will be correctly set within one year; that all water boundaries and wet lands, as defined in Minnesota Statutes, Section 505.01, Subd. 3, as of the date of this certificate are shown and labeled on this plat; and all public ways are shown and labeled on this plat. Dated this ________ day of _____________________, 20___. _________________________________ Daniel J. Roeber, Licensed Land Surveyor Minnesota License Number 43133 STATE OF MINNESOTA COUNTY OF _________________________________ This instrument was acknowledged before me on , by Daniel J. Roeber. __________________________________________________ (Notary Signature) ___________________________________________________(Notary Printed Name) NOTARY PUBLIC, _____________________ MY COMMISSION EXPIRES __________________________________ KNOW ALL PERSONS BY THESE PRESENTS: That PLACE, LLC, a Minnesota limited liability company, owner of the following described property: Tract B: Lots 3, 4, 9, 10 and part of Lots 2 and 11, Block 30, "Rearrangement Of St. Louis Park", and part of Lots 20 to 23, both inclusive, Block 29, "Rearrangement Of St. Louis Park", and that part of vacated Zarthan Avenue, all being described as follows: Beginning at a point on the Southwesterly line of said Block 30 distant 2.4 feet Southerly, measured along said Southwesterly line, from the Northwesterly corner of said Block 30; thence Northeasterly in a straight line to a point on the East line of said Block 30 distant 6.67 feet South, measured along said East line, from the Northeasterly corner of said Block 30; thence continue Northeasterly along said last described course 56.97 feet; thence Southeasterly at right angles 20.57 feet; thence Northeasterly at right angles 86.47 feet; thence Southerly a distance of 89.59 feet, more or less, to the North line of the alley in Block 29, "Rearrangement Of St. Louis Park", said point being 79 feet East of the Southwest corner of Lot 20 in said Block 29; thence Westerly along the North line of said alley and the same extended to the West line of Zarthan Avenue; thence South along the West line of Zarthan Avenue to the Southerly corner of Lot 4, Block 30, "Rearrangement Of St. Louis Park"; thence Northwesterly along the Southwesterly line of said Lot 4 to the Southeasterly corner of Lot 9 in said Block 30; thence Southwesterly along the Southeasterly line of said Lot 9 to the Southwesterly corner of said Lot 9; thence Northwesterly along the Southwesterly line of said Block 30 to the place of beginning; Except that part of said Lot 4, Block 30, lying South of a line described as: Commencing at a point in the Southwest line of said Lot 4, distant 26 feet Northwest of the most Southerly corner of said Lot 4, thence Northeast to a point in the East line of said Lot 4, distant 29 feet North of the most Southerly corner. That part of Zarthan Avenue and that part of the alley in Block 29, "Rearrangement Of St. Louis Park" lying South of the North line of the alley in Block 29, "Rearrangement Of St. Louis Park" and the same extended West to the West line of said Zarthan Avenue, and Northwesterly of a line drawn from a point on the Easterly line of Lot 4, Block 30, "Rearrangement Of St. Louis Park" distant 38.72 feet Northerly from the most Southerly corner of said Lot 4 to a point on the South line of Lot 20, Block 29, "Rearrangement Of St. Louis Park" distant 6.7 feet East of the Southwest corner of said Lot 20. That part of the vacated East-West alley dedicated in Block 29, "Rearrangement Of St. Louis Park" which lies North of the center line of said alley and between the Southerly extensions of the West line of Lot 20, said Block and Addition, and the following described line: Commencing at a point on the Southwesterly line of said Block 30 distant 2.4 feet Southerly, measured along said Southwesterly line, from the Northwesterly corner of said Block 30; thence Northeasterly in a straight line to a point on the East line of said Block 30 distant 6.67 feet South, measured along said East line, from the Northeasterly corner of said Block 30; thence continue Northeasterly along said last described course 56.97 feet; thence Southeasterly at right angles 20.57 feet; thence Northeasterly at a right angle 86.47 feet to the actual point of beginning of the line to be described; thence South to a point on the South line of said Lot 20 distant 79 feet East from Southwest corner of said Lot 20. Being Registered land as is evidenced by Certificate of Title No. 1124712. AND Tract A: Lots 5, 6, 7, and 8, Block 30, "Rearrangement of St. Louis Park, according to the recorded plat thereof, Hennepin County, Minnesota. Being Registered land as is evidenced by Certificate of Title No. 517068. Together with that part of the West 1/2 of all that part of vacated Earle St., aka Zarthan Ave., dedicated by the "Plat of St. Louis Park", lying northerly of Highland Ave., aka 36th St., and southerly of the westerly extension of the north line of the alley situated in Block 29, "Plat of St. Louis Park", which would accrue thereto by reason of the vacation thereof. Tract B: Parcel 1: That part of Lot 4, Block 30, "Rearrangement of St. Louis Park", lying South of the following described line: Commencing at a point in the Southwest line of said Lot 4, 26 feet Northwest of the most Southerly corner of said Lot 4, thence Northeast to a point in the East line of said Lot 4, 29 feet North of the most Southerly corner. Together with that part of the West 1/2 of all that part of vacated Earle St., aka Zarthan Ave., dedicated by the "Plat of St. Louis Park", lying northerly of Highland Ave., aka 36th St., and southerly of the westerly extension of the north line of the alley situated in Block 29, "Plat of St. Louis Park", which would accrue thereto by reason of the vacation thereof. Parcel 2: Lots 6 and 7, including that part of the adjoining vacated alley lying South of the center line thereof and between the extensions North to said center line of the West line of Lot 6 and the East line of Lot 7, all in Block 29, "St. Louis Park". Together with that part of the East 1/2 of all that part of vacated Earle St., aka Zarthan Ave., dedicated by the "Plat of St. Louis Park", lying northerly of Highland Ave., aka 36th St., and southerly of the westerly extension of the north line of the alley situated in Block 29, "Plat of St. Louis Park", which would accrue thereto by reason of the vacation thereof. Hennepin County, Minnesota. Being Registered land as is evidenced by Certificate of Title No. 525746. Parcel 8: Tract A: Lot 11; those parts of Lots 12, 13, 14, 21, 22 and 23, Block 29; those parts of Lots 2 and 11, Block 30; that part of the adjoining vacated north-south alley lying in Block 29, and vacated Zarthan Avenue, "Rearrangement of St. Louis Park" described as follows: Commencing at the west quarter corner of Section 6, Township 28 North, Range 24 West of the 4th Principal Meridian, Hennepin County, Minnesota; thence South 00 degrees 14 minutes 49 seconds East, assumed bearing, along the west line of the Southwest Quarter of said Section 6 a distance of 492.57 feet to the southerly right of way line of the Canadian Pacific Railroad, shown as the Chicago, Milwaukee and St. Paul Railway on said plat of "Rearrangement of St. Louis Park"; thence continuing South 00 degrees 14 minutes 49 seconds East along said west line 80.00 feet; thence South 65 degrees 52 minutes 15 seconds West, 955.17 feet to the east line of said Lot 12 and the point of beginning of the parcel to be described; thence continuing South 65 degrees 52 minutes 15 seconds West, 162.71 feet to the southerly line of said Lot 14; thence North 88 degrees 58 minutes 35 seconds West, 18.23 feet along said southerly line and its westerly extension to the centerline of said alley; thence North 00 degrees 57 minutes 33 seconds East, 4.17 feet along said centerline; thence South 65 degrees 21 minutes 14 seconds West, 183.14 feet; thence North 24 degrees 38 minutes 46 seconds West, 20.57 feet; thence South 65 degrees 21 minutes 14 seconds West, 252.73 feet to the southwesterly line of said Lot 11, Block 30; thence North 39 degrees 00 minutes 57 seconds West, 2.40 feet along said southwesterly line to the said southerly right of way line; thence North 64 degrees 17 minutes 59 seconds East, 451.50 feet along said southerly right of way line; thence North 64 degrees 21 minutes 45 seconds East, 185.28 feet along said southerly right of way line to the east line of said Lot 11, Block 29; thence southerly along the east line of said Lots 11 and 12 to the point of beginning. Tract B: Lot 6 and those parts of Lots 7, 8, and 11 thru 21, Block 25, "Rearrangement of St. Louis Park" described as follows: Commencing at the west quarter corner of Section 6, Township 28 North, Range 24 West of the 4th Principal Meridian, Hennepin County, Minnesota; thence South 00 degrees 14 minutes 49 seconds East, assumed bearing, along the west line of the Southwest Quarter of said Section 6 a distance of 492.57 feet to the southerly right of way line of the Canadian Pacific Railroad shown as the Chicago, Milwaukee and St. Paul Railway in the plat of "Rearrangement of St. Louis Park"; thence continuing South 00 degrees 14 minutes 49 seconds East along said west line 80.00 feet; thence South 65 degrees 52 minutes 15 seconds West, 526.90 feet to the east line of said Lot 7 and the point of beginning of the parcel to be described; thence continuing South 65 degrees 52 minutes 15 seconds West, 361.97 feet to the west line of said Lot 21; thence North 01 degrees 03 minutes 00 seconds East, 54.70 feet along said west lot line to said southerly railroad right of way line; thence North 64 degrees 21 minutes 45 seconds East, 366.58 feet along said southerly right of way line to the east line of said Lot 6; thence southerly along the east line of said Lots 6 and 7 to the point of beginning. (Abstract Property) AND Tract A: That part of the following described property: That part of Lots 20, 21, 22 and 23, Block 29, "Rearrangement Of St. Louis Park" and that part of the adjoining vacated alleys, all described as commencing at a point on the Southwesterly line of Block 30, "Rearrangement Of St. Louis Park" distant 2.4 feet Southerly, measured along said Southwesterly line, from the Northwesterly corner of said Block 30; thence Northeasterly to a point on the East line of said Block 30 distant 6.67 feet South, measured along said East line from the Northeasterly corner of said Block 30; thence continuing Northeasterly along the last described course a distance of 56.97 feet; thence Southeasterly at a right angle 20.57 feet; thence Northeasterly at a right angle 86.47 feet to the actual point of beginning; thence continuing Northeasterly along the last described course to the center line of the vacated alley adjoining the East line of said Lots 20, 21, 22 and 23; thence South along said center line and its extension to the center line of the vacated alley adjoining the South line of said Lot 20, thence West along the last described center line to its intersection with the extension South of a line drawn from the actual point of beginning to a point on the South line of said Lot 20 distant 79 feet East from the Southwest corner of said Lot 20; thence North to the actual point of beginning; Which lies Westerly of the East line of Lot 7 of said Block 29, extended Northerly. STATE OF MINNESOTA COUNTY OF _________________________________ This instrument was acknowledged before me on , by XXXXXXXXXX, principal of PLACE, LLC, a Minnesota limited liability company, on behalf of the company. ____________________________________________________ (Notary Signature) ____________________________________________________ (Notary Printed Name) NOTARY PUBLIC, _____________________ MY COMMISSION EXPIRES __________________________________ RESIDENT AND REAL ESTATE SERVICES, Hennepin County, Minnesota I hereby certify that taxes payable in 20_____ and prior years have been paid for land described on this plat, dated this ________day of _______________________, 20______. Mark V. Chapin, County Auditor by ______________________________________ Deputy SURVEY DIVISION, Hennepin County, Minnesota Pursuant to MN STAT. Sec. 383B.565 (1969), this plat has been approved this ________day of _______________________, 20______. Chris F. Mavis, County Surveyor by ______________________________________ RESISTRAR OF TITLES, Hennepin County, Minnesota I hereby certify that the within plat of PLACE was filed in this office this ________day of _______________________, 20______ , at ____o'clock ____m. Martin McCormick, Registrar of Titles by ______________________________________ Deputy COUNTY RECORDER, Hennepin County, Minnesota I hereby certify that the within plat of PLACE was filed in this office this ________day of _______________________, 20______ , at ____o'clock ____m. Martin McCormick, County Recorder by ______________________________________ Deputy PLACE SHEET 1 OF 3 SHEETS R.T. DOC. NO. _______________________ C.R. DOC. NO. _______________________ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 56 6 6 8 .1 7 S64 °2 1 '4 5 "W 132.21S55°39'42"W 2 8 0 .4 6 S64 °2 1 '4 5 "W S25°38'15"E197.40N 6 4 °1 0 '5 2 "E 8 5 3 .8 7 1 0 1.5 2 N 4 1 ° 3 1'4 1" WN01°19'57"W95.651001008 08029.006 0 0 .0 0 S o u th w e s te rly c o rn e ro fA U D IT O R 'S S U B D IV IS IO N N U M B E R 2 4 9 (5 0 .0 0 fe e tn o rth w e ste rly fro m c e n te rlin e o fs o u th b o u n d m a in tra ck ,n o w a b a n d o n e d )Sout hwe s t erl y boun dar yli neofAUDITOR' S SUBDI VI SI ONNUMBER249N 6 4 °2 1 '4 5 "E 1 8 5 .2 7 N 6 4 °1 7'5 9 "E 4 5 1 .5 0 4 4 0 .7 135 3 6 .3 9 2 4 4 .0 7 112.67N 6 4 °2 5 '1 4 "E 3 7 6 .5 1 1 8 .1 0 S 4 1 °3 1 '4 1 "E 4 9.7 0 353 5 20 20 34.7059.83R=138.00Δ=24°50'33"1 2 9 .4 3 S 6 4 °2 8 '5 0 "W 233.82R=1262.00Δ=10°36'56"137.75S53°51'54"W 3 4 2 .9 9 1 5 .3 6 2 0 9 .9 3 92.96R=115.00Δ=46°18'52"156.84N18°06'21"E186.37N18°06'21"E19.54 3 6 0 .3 9 N 6 4 °2 5 '1 4 "E 5 5 .9 8 6 1 2 .1 9Δ=34°58'21"R=120.0073.25138.75N53°04'43"E2 8 4 .0 5 LOT 1, BLOCK 2 S 3 7 ° 1 5'4 9 " E 1 4 3.0 2 S49°04'16"E 173.94 6060M IN N E S O T A 7 S E R V IC E R O A D SERVICEROAD505050 50 MINNESOTA7D R A IN A G E &U T IL IT Y E A S E M E N T 51010 10 1 0 1 0 WO O D D A L E A V E. S.29.006 0 0 .0 0 30501 4 CenterlineofspurtrackC e n te rlin e o fC h ic a g o a n d N o rth W e ste rn T ra n sp o rta tio n C o m p a n y (fo rm a lly M in n e a p o lisa n d S tL o u is R a ilw a y C o m p a n y )sp u rtra c k IC C N o .2 5 3 N orth e asterly lin e of Wo o d D ale A v e n u e (for m ally k n o w n a s Ple asa nt A v e n u e)50 50166.50Westerly line of Lot 6,Block 23, ST LOUIS PARKEXCEPTIO N35.00194 .0 0 168.402 7 3 .4 4 131.79122.40R=120.00Δ=58°26'30"30.99218.40R=180.00Δ=69°31'00"N 55°44'40"E212.27LOT 1, BLOCK 1 O U T L O T A MATCH LINE MATCH LINE 5 141.49N01°03'00"EN 6 4 °2 1 '4 5 "E 3 6 6 .5 8 65.34S01°00'38"W1 6 7 .7 5 1 9 8 .8 3 S o u th e rly rig h to fw a y o fth e C a n a d ia n P a c ific R a ilro a d ,su c c e ss o rto t h e C h ic a g o ,M ilw a u k e e R a ilw a y a s s h o w n o n th e P la to fR E A R R A N G E M E N T O F S T L O U IS P A R K East line of Lot 7, Block 25, REARRANGEMENT OF ST 2 5 2 .7 3 S 6 5 °2 1 '1 4 "W5 23.682 5 1 .1 4 N 6 3 °3 9 '2 3 "E 9 2 .9 0 N 6 4 °2 4 '0 0 "E 4 .7 3 -S 2 4 °3 5 '3 2 "E 5 7 .3 5 S 2 4 °3 5 '3 2 "E 1 6 0 .1 2 N 6 4 °1 9 '0 5 "E 10D R A IN A G E &U T IL IT Y E A S E M E N T D R A IN A G E &U T IL IT Y E A S E M E N T 101010 10 1051 9 9 .0 0 PLUG INSCRIBED WITH 43133IRON MONUMENT SET WITH PLASTICDENOTES 1/2 INCH BY 14 INCH DENOTES IRON MONUMENT FOUND 40 800 Horizontal Scale In Feet PLACE SEC. 16, TWP. 117, RNG. 16 (NOT TO SCALE) BEING 10 FEET IN WIDTH UNLESS OTHERWISE INDICATED1010 SHOWN THUS: DRAINAGE & UTILITY EASEMENTS (NOT TO SCALE) SITE BEARINGS ARE BASED ON THE WEST LINE OF THE SOUTHWEST QUARTER OF SECTION 6, TOWNSHIP 28, RANGE 24 WHICH IS ASSUMED TO HAVE A BEARING OF SOUTH 00 DEGREES 14 MINUTES 49 SECONDS WEST. R.T. DOC. NO. _______________________ C.R. DOC. NO. _______________________ SHEET 2 OF 3 SHEETSWestquartercornerofSec.6,Twp. 28 North, Rng. 24West line of the SouthwestQuarter of Sec. 6, Twp. 28North, Rng. 24 SEC. 6, TWP. 028, RNG. 24 (NOT TO SCALE)Southwest corner of Sec. 6,Twp. 28 North, Rng. 24 5 2 6 .9 0 S 6 5 °5 2 '1 5 "W 80.00S00°14'49"W2062.14N00°14'49"E5 2 6 .9 0 S 6 5 °5 2 '1 5 "W S00°14'49"W315.51City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 57 6 6 8 .1 7 S64 °2 1 '4 5 "W 132.21S55°39'42"W 2 8 0 .4 6 S64 °2 1 '4 5 "W 1001008080S o u th w e ste rly co rn e ro fA U D IT O R 'S S U B D IV IS IO N N U M B E R 2 4 9 (5 0 .0 0 fe e tn o rth w e s te rly fro m c e n te rlin e o fs o u th b o u n d m a in tra c k ,n o w a b a n d o n e d )a r y li neDI VI SI ONN 6 4 °2 1 '4 5 "E 1 8 5 .2 7 52.75S01°03'00"W1 6 2 .7 1 S 6 5 °5 2 '1 5 "W 1 8 . 2 3 N 8 8 ° 5 8'3 5 "W37.71S65°21'14"W4 .1 7 N 0 0 ° 5 7'3 3 " E 286.67S00°57'33"W256.56 N88°58'35"W 1 7 5 . 7 7 N 3 9 ° 0 0'5 7 "WN 6 4 °1 7'5 9 "E 4 5 1 .5 0 79.00 8 6 .4 7 2 6.0 29.01 4 8.1 5 264.70 4 4 0 .7 1 26.00262610.510.5260.671 0.7 935 3 6 .3 9 2 4 4 .0 7 112.671 8 .1 0 S 4 1 °3 1 '4 1 "E 3 6 0 .3 9 N 6 4 °2 5 '1 4 "E 5 5 .9 8 6 1 2 .1 9 S 3 7 ° 1 5'4 9 " E 1 4 3.0 2 S49°04'16"E 173.94 6060M IN N E S O T A 7 S E R V IC E R O A D 36TH STREET WEST 1 0 WO O D D A L E A V E. S. 5 5 6 0 0 .0 0 30501 4 CenterlineofspurtrackC e n te rlin e o fC h ica g o a n d N o rth W e ste rn T ra n sp o rta tio n C o m p a n y (fo rm a lly M in n e a p o lisa n d S tL o u isR a ilw a y C o m p a n y )sp u rtra ck IC C N o .2 5 3 N orth e asterly lin e of Wo o d D ale A v e n u e (for m ally k n o w n a s Ple asa nt A v e n u e)5050218.40R=180.00Δ=69°31'00"O U T L O T A MATCH LINE MATCH LINE 5LOT 1, BLOCK 3 3 6 1 .9 7 S 6 5 °5 2 '5 1 "W N01°03'00"E54.70N 6 4 °2 1 '4 5 "E 3 6 6 .5 8 65.34S01°00'38"W6 5 ° 6 5 ° 6 ° 6 5 ° 1 6 5 .6 2 1 6 7 .7 5 1 9 8 .8 3 1 9 6 .3 5 60.46N01°00'38"EOUTLOT B OUTLOT C S o u th e rly rig h to fw a y o fth e C a n a d ia n P a cific R a ilro a d ,su c c e sso rto th e C h ic a g o ,M ilw a u k e e R a ilw a y a s sh o w n o n th e P la to fR E A R R A N G E M E N T O F S T L O U IS P A R K East line of Lot 7, Block 25, REARRANGEMENT OF ST LOUIS PARK S 6 5 °2 1 '1 4 "W 1 8 3 .1 4 20.57N24°38'46"W2 5 2 .7 3 S 6 5 °2 1 '1 4 "W 1 1 9 .7 5 S 6 4 °2 6 '2 1 "W 6.67 89.59533.43S84°18'46"E 23.682 5 1 .1 4 N 6 3 °3 9 '2 3 "E 4.64 N25°35'56"W 9 2 .9 0 N 6 4 °2 4 '0 0 "E 4 .7 3 -S 2 4 °3 5 '3 2 "E 5 7 .3 5 S 2 4 °3 5 '3 2 "E 1 6 0 .1 2 N 6 4 °1 9 '0 5 "E 10101010D R A IN A G E &U T IL IT Y E A S E M E N T D R A IN A G E &U T IL IT Y E A S E M E N T PLACE R.T. DOC. NO. _______________________ C.R. DOC. NO. _______________________ SHEET 3 OF 3 SHEETS 5 2 6 .9 0 S 6 5 °5 2 '1 5 "W West quarter corner of Sec. 6,Twp. 28 North, Rng. 24West line of the SouthwestQuarterofSec.6,Twp.28North, Rng. 242062.14N00°14'49"ESouthwest corner of Sec. 6,Twp. 28 North, Rng. 24492.57S00°14'49"W80.00S00°14'49"WSEC. 16, TWP. 117, RNG. 16 (NOT TO SCALE) SITE SEC. 6, TWP. 028, RNG. 24 (NOT TO SCALE) PLUG INSCRIBED WITH 43133IRON MONUMENT SET WITH PLASTICDENOTES 1/2 INCH BY 14 INCH DENOTES IRON MONUMENT FOUND 40 800 Horizontal Scale In Feet BEING 10 FEET IN WIDTH UNLESS OTHERWISE INDICATED1010 SHOWN THUS: DRAINAGE & UTILITY EASEMENTS (NOT TO SCALE) BEARINGS ARE BASED ON THE WEST LINE OF THE SOUTHWEST QUARTER OF SECTION 6, TOWNSHIP 28, RANGE 24 WHICH IS ASSUMED TO HAVE A BEARING OF SOUTH 00 DEGREES 14 MINUTES 49 SECONDS WEST. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 58 Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 3/7/2017 5:35:46 PMC:\Projects\PLACE_PUD-Resp-02_Site_danm.rvtG001 COVER SHEETPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 SHT NO SHEET NAME CIVIL C001 EXISTING CONDITIONS AND REMOVALS C003 TREE REMOVALS AND PRESERVATION PLAN C101 SITE PLAN-OVERALL C102 SITE PLAN-NORTHWEST C103 SITE PLAN-NORTHEAST C104 SITE PLAN-SOUTH C201 TEMPORARY EROSION CONTROL PLAN C301 GRADING AND DRAINAGE PLAN - OVERALL C401 SANITARY SEWER AND WATERMAIN C402 STORM SEWER PLAN C801 SITE DETAILS C802 SITE DETAILS C901 CITY OF ST. LOUIS PARK STANDARD DETAILS C902 CITY OF ST. LOUIS PARK STANDARD DETAILS C903 CITY OF ST. LOUIS PARK STANDARD DETAILS C1001 MnDOT STANDARD PEDESTRIAN CURB RAMP DETAILS C1002 MnDOT STANDARD PEDESTRIAN CURB RAMP DETAILS LANDSCAPE L101 PLANTING PLAN-OVERALL L102 PLANTING PLAN-NORTHWEST L103 PLANTING PLAN-NORTHEAST L104 PLANTING PLAN-SOUTH L801 PLANTING DETAILS ELECTRICAL E101 ELECTRICAL SITE PLAN-OVERALL al V302 ALTA Survey V101 PRELIMINARY PLAT V102 PRELIMINARY PLAT V103 PRELIMINARY PLAT V301 ALTA/NSPS LAND TITLE SURVEY SHT NO SHEET NAME GENERAL G001 COVER SHEET S001 SITE PLAN ARCHITECTURAL A101 NORTH BLDG FLOOR PLANS A102 NORTH BLDG FLOOR PLANS A103 NORTH BLDG FLOOR PLANS A104 NORTH BLDG FLOOR PLANS A105 NORTH BLDG FLOOR PLANS A106 NORTH BLDG ELEVATIONS A107 NORTH BUILDING ILLUSTRATIVE ELEVATIONS A201 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A202 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A203 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A204 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A205 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A206 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A207 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A208 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A209 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANS A210 SOUTH BLDG ELEVATIONS A211 HOTEL ELEVATIONS A212 SOUTH BUILDING ILLUSTRATIVE ELEVATIONS A301 E-GEN FLOOR PLANS A302 E-GEN FLOOR PLANS A303 E-GEN ELEVATIONS A401 3D VIEW A501 ILLUSTRATIVE SECTIONS A502 TECHNICAL SECTIONS GENERAL G002 LEGEND G003 GENERAL NOTES PLACE, ST. LOUIS PARK, MN City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 59 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 60 1 A502 1 A502 A106 1 A106 2 A106 4 A106 6 A106 3 A106 5 EXERCISE 894 SF SOUND PROOF ROOM 606 SF STORAGE 6639 SF BIKE STORAGE 2650 SF 15 10 23 29 14 8 MECH 486 SF VAN ELEC CAR CHARGING STATION (TYP) 1 2 3 4 5 6 7 LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STORAGE LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET GREEN ROOF/SOLAR PANELS BIKE STORAGE GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 3:04:17 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA101 NORTH BLDG FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A101 1 BASEMENT FLOOR PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 61 SEE LANDSCAPE DWG’S FOR ALL EXTERIOR SPACES/AREAS PROPERTY LINE LAUNDRY 337 SF MAKER SPACE 2624 SF RETAIL 2484 SF LOBBY MAIL MECH 1401 SF MECH 1410 SF TRASH 660 SF 1 A502 1 A502 A106 1 A106 2 A106 4 A106 6 A106 3 A106 5 SETBACK LINE SEE LANDSCAPE DWG’S FOR ALL EXTERIOR SPACES/AREAS PROPERTY LINE LAUNDRY 337 SF MAKER SPACE 2624 SF RETAIL 2484 SF LOBBY MAIL MECH 1401 SF MECH 1410 SF TRASH 660 SF SETBACK LINE SHARED TOILETS HCRRA SETBACK LINE3' - 0" 2 ' - 0 " 2 ' - 0 "4' - 0"HCRRA SETBACK LINE LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STORAGE LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET GREEN ROOF/SOLAR PANELS BIKE STORAGE GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 3/7/2017 2:01:42 PMC:\Projects\PLACE_PUD-Resp-02_Site_shqipe@msrdesign.com.rvtA102 NORTH BLDG FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A102 1 GROUND/1ST FLOOR PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 62 MECH 338 SF LAUNDRY 198 SF MECH 408 SF 1 A502 1 A502 OUTDOOR PATIO A106 1 A106 2 A106 4 A106 6 A106 3 A106 5 MECH 338 SF LAUNDRY 198 SF MECH 408 SF ROOF DECK 735 SF OUTDOOR PATIO GREEN ROOF 1,767 SF 3' - 0" 2 ' - 0 "4' - 0"2 ' - 0 " ROOF DECK 735 SF GREEN ROOF 1,767 SF LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STORAGE LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET GREEN ROOF/SOLAR PANELS BIKE STORAGE GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 3/7/2017 2:01:56 PMC:\Projects\PLACE_PUD-Resp-02_Site_shqipe@msrdesign.com.rvtA103 NORTH BLDG FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A103 1 2ND FLOOR PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 63 LAUNDRY 198 SF MECH 408 SF 1 A502 1 A502 A106 1 A106 2 A106 4 A106 6 A106 3 A106 5 OUTDOOR PATIO MECH 338 SF MECH 408 SF LAUNDRY 198 SF 3' - 0"4' - 0" 2 ' - 0 " 2 ' - 0 " LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STORAGE LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET GREEN ROOF/SOLAR PANELS BIKE STORAGE GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 3/7/2017 2:02:11 PMC:\Projects\PLACE_PUD-Resp-02_Site_shqipe@msrdesign.com.rvtA104 NORTH BLDG FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A104 1 3RD - 5TH FLOOR PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 64 A108 1 A108 2 A108 4 A108 6 A108 3 A108 5 MECH SCREEN DOAS UNIT ROOF HATCH MECH SCREEN (SEE DETAIL 2 ON THIS SHEET) GREEN ROOF DIRECT OUTSIDE AIR SYSTEM (DOAS) STAIR ROOF HATCH ACCESS (TYP) SOLAR PANELS (TYP) ELEVATOR OVERRUN SERVICE WALKING SYSTEM 3’ – 0” WIDE MINIMUM 2 ' - 0 "4' - 0" 2 ' - 0 "3' - 0" WIND TURBINE LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STORAGE LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET GREEN ROOF/SOLAR PANELS BIKE STORAGE GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD ART LIGHT AND DISPLAY SYSTEM LOCATION Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 4/7/2017 12:38:52 PMC:\Projects\PLACE_PUD-Rev-03_Site_shqipe@msrdesign.com.rvtA107 NORTH BLDG FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017/04/05 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 04/05/2017 PUD REVISION 03 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A107 1 ROOF PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE TYP ROOF MECHANICAL EQUIPMENT SCREEN2 NOT TO SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 65 'A' SOUTH ELEVATION PLACE ST.LOUIS PARKDrawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.ST. LOUIS PARK, MN tel 100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-04-05 DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE PUD Submission MD1101500 Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 DATEMARK DESCRIPTION tel 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 04/05/2017 PUD REVISION 03 A106 NORTH BLDG ELEVATIONS 1 1/16" = 1' - 0"A106 1ST 0' 2ND 13'-2" 3RD 23'-10" 4TH FLR 34'-6" 5TH FLR 45'-2" ROOF 56'-8" BSMNT. -11'-2" T.O. PARAPET 60'-2" EXIST GRADE VTAC GRILLE (TYP)GREEN WALL (TYP) PHOTOVOLTAIC PANELS (TYP) EXT ENTRY LIGHT (TYP)FORESHORTENED ELEVATION ENDURAMAX BRICK (TYP) DOAS UNIT METAL SCREEN (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ARTWORK DISPLAY AREA (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) ARTWORK & BALCONY LIGHTING (TYP) 4' WALL DEVIATION SOLAR PANELS WIND TURBINE DOAS UNIT SCREEN (T VTAC GRILLE (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ENDURAMAX BRICK (TYP)ARTWORK & BALCONY LIGHTING (TYP) ARTWORK DISPLAY AREA (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) 2' WALL DEVIATION WIND TURBINE BIKE SHOP0000 0000 ENTRYEXIT NORTH PLACE GARAGE RAMP DOAS UNIT METAL SCREEN (TYP) VTAC GRILLE (TYP) PHOTOVOLTAIC PANELS (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) FORESHORTENED ARTWORK DISPLAY AREA (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) BUILDING ADDRESS (TYP) ELEVATION SOLAR PANELS WIND TURBINE BIKE SHOP 00000000 1ST FLR 0' 2ND FLR 13'-2" 3RD FLR 23'-10" 4TH FLR 34'-6" 5TH FLR 45'-2" RF. 56'-8" BSMNT. -11'-2" T.O. PRPT. 60'-2" BIKE SHOPBIKE SHOPBKESOP 0000000000000000000 SOLAR PANELS DOAS (DEDICATED OUTDOOR AIR SYSTEM) UNIT METAL SCREEN (TYP) VTAC GRILLE (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) ARTWORK & BALCONY LIGHTING (TYP) ARTWORK DISPLAY AREA (TYP) EXT ENTRY LIGHT (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) FORESHORTENED ELEVATION 3' WALL DEVIATION 2' WALL DEVIATION EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) BUILDING ADDRESS (TYP) WIND TURBINE 'B' WEST ELEVATION 1/16" = 1' - 0" 5 A106 'D' EAST ELEVATION3 1/16" = 1' - 0"A106 'C' NORTH ELEVATION6 1/16" = 1' - 0"A106 VTAC GRILLE (TYP) EXIST GRADE PHOTOVOLTAIC PANELS (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) ARTWORK DISPLAY AREA (TYP) EXT ENTRY LIGHT (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) 'F' URBAN FOREST WEST FACING ELEVATION4 1/16" = 1' - 0"A106 DOAS UNIT METAL SCREEN (TYP) EXIST GRADE VTAC GRILLE (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) FORE- SHORTENED ARTWORK DISPLAY AREA (TYP) EXT ENTRY LIGHT (TYP) EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) ELEVATION 'E' URBAN FOREST EAST FACING ELEVATION2 1/16" = 1' - 0"A106 8'16'32' 1/16" = 1' - 0" GRAPHIC SCALE 0' ELEVATIONS LEGEND FIRST FLOOR 0' (T.O. PODIUM) SECOND FLOOR 13'-2" THIRD FLOOR 23'-10" FOURTH FLOOR 34'-6" FIFTH FLOOR 45'-2" BASEMENT -11'-2"11'-2"13'-2"10'-8"10'-8"10'-8"11'-6"ROOF 56'-8" T.O. PARAPET 60'-2"3'-6"FIRST FLOOR 0' (T.O. PODIUM) SECOND FLOOR 13'-2" THIRD FLOOR 23'-10" FOURTH FLOOR 34'-6" FIFTH FLOOR 45'-2" BASEMENT -11'-2"11'-2"13'-2"10'-8"10'-8"10'-8"11'-6"ROOF 56'-8" T.O. PARAPET 60'-2"3'-6"D C1 E F ARTWORK DISPLAY AREA BUILDING SIGNAGE AREA ART & BALCONY LIGHT EXT CANOPY MOUNTED CYLINDER DOWNLIGHT EXT ENTRY LIGHT LEGEND 1. SEE OTHER SUBMITTED SIGNAGE PACKAGE FOR ACTUAL HEIGHT AND AREA OF ALL BUILDING SIGNAGE. 2. SEE SUBMITTED DOCUMENT "POTENTIAL OPPORTUNITIES FOR LIVING ARTS IN PLACE COMMUNITIES", SPECIFICALLY THE "ARCHITECTURAL IMPLICATIONS" SHEET, FOR FURTHER DETAILS ON ARTWORK DISPLAY AREAS ON ELEVATIONS INDICATED ON THIS SHEET. NOTES FACES IN PUBLIC RIGHT OF WAY TRANSPARENT SURFACE ANALYSIS (SEE SHEET A211) A1 A2 A3 A4 B1 B2 B3 C2 C3 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 66 Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 1:18:06 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA107 NORTH BUILDING ILLUSTRATIVE ELEVATIONSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE SOUTH ELEVATION - SUMMER VIEW1 A107 1/16" = 1' - 0" SOUTH ELEVATION - WINTER VIEW2 A107 1/16" = 1' - 0" City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 67 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 68 0 REF REF REF REF REFUP UP UP UP UP 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 COFFEE HOUSE 1,173 SF MECH & TRASH 531 SF BAR/KITCHEN CAFE 4,644 SF HOTEL LOBBY 2,811 SF HOTEL GROUND FLOOR GROSS 9,791 SF MECH & TRASH 531 SF CO-WORKING 1,571 SF RES. GROUND FLOOR GROSS 7,675 SF TRASH 263 SF MAIL LOBBY L/W TYPE II STOREFRONT 250 SF MECH 255 SF UP DN UP DN RETAIL 185 SF L/W TYPE II STOREFRONT 250 SF L/W TYPE II STOREFRONT 252 SF L/W TYPE II STOREFRONT 300 SF L/W TYPE II STOREFRONT 250 SF VAN ELEC CAR CHARGING STATION (TYP) 6 4 10 12 18 1 2 3 4 5 6 7 2 SETBACK LINE PROPERTY LINE HOTEL BRIDGE RESIDENTIAL/PARKING LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 3/7/2017 2:02:14 PMC:\Projects\PLACE_PUD-Resp-02_Site_shqipe@msrdesign.com.rvtA202 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A202 1 GROUND/1ST FLOOR PLAN N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 69 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 UP DN UP 7 4 11 12 18 2 OPEN TO BELOW HOTEL BRIDGE RESIDENTIAL/PARKING LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:52:57 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA203 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A203 1 PARTIAL PARKING PLAN/ LIVE/WORK MEZZANINE FLOOR PLANS NOTE: THIS DWG REPRESENTS THE PARKING LEVEL INTERSTITIAL SPACE BETWEEN BUILDING FLOORS 1 AND 2 N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 70 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 COMMONS 838 SF COMMONS 4,644 SF MECH 187 SF CO-WORKING 2,415 SF MECH 740 SF 7 4 11 15 18 3 2 OPEN TO BELOW DN UP HOTEL BRIDGE RESIDENTIAL/PARKING LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:53:01 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA204 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A204 1 2ND FLOOR PLANS N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 71 MECHLAUNDRY 173 SF MECH 187 SF 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 MECH 187 SF MECHLAUNDRY 173 SF PARKING BELOW HOTEL BRIDGE RESIDENTIAL LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:53:03 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA205 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A205 1 3RD FLOOR PLANS N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 72 MECH 321 SF LAUNDRY 173 SF MECH 187 SF 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 HOTEL BRIDGE RESIDENTIAL MEETING/PERFORMANCE /GALLERY SPACE 1,115 SF LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:53:06 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA206 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A206 1 4TH FLOOR PLANS N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 73 MECH 187 SF MECH 321 SF LAUNDRY 173 SF 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 MECH 187 SF MECH 321 SF LAUNDRY 173 SF MECH 187 SF ROOF DECK MECH 321 SF LAUNDRY 173 SF HOTEL BRIDGE RESIDENTIAL LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:53:10 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA207 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A207 1 5TH FLOOR PLANS N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 74 MECH MECH 321 SF LAUNDRY 173 SF 2 A502 2 A502 3 A502 3 A502 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 MECH MECH 321 SF LAUNDRY 173 SF HOTEL BRIDGE RESIDENTIAL LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 2:53:13 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA208 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 1/16" = 1'-0"A208 1 6TH FLOOR PLANS N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 75 LEGEND RESIDENTIAL STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH LIVE/WORK UNITS TYPE I - AFFORDABLE LIVE/WORK UNITS TYPE II DWELLING UNITS - AFFORDABLE RETAIL MAKER/CO-WORKING STAIR/ELEV CORE CIRCULATION SPACE COMMONS MECH/TRASH CAFE DOUBLE ROOM KING ROOM EXTENDED STAY SUITE PRESIDENTIAL SUITE STORAGE STORAGE HOTEL LIVE/WORK UNITS TYPE I - MARKET DWELLING UNITS - MARKET BIKE STORAGE ADDITIONAL SPACE GREEN ROOF/SOLAR PANELS GREEN/SOD ROOF BIKE PARKING HOR FLR MTD BIKE PARKING VERT WALL MTD ART LIGHT AND DISPLAY SYSTEM LOCATION GREEN ROOF/SOLAR PANELS A210 1 A210 2 A210 3 A2104 A211 1 A211 2 A211 3 A2114 GREEN ROOF GREEN ROOF STAIR ROOF HATCH ACCESS (TYP) SOLAR PANELS (TYP) ELEVATOR OVERRUN SERVICE WALKING SYSTEM 3’ – 0” WIDE MINIMUM ROOF ACCESS HATCH MECH SCREEN DIRECT OUTSIDE AIR SYSTEM (DOAS) UNIT MECH SCREEN DOAS UNIT ROOF ACCESS HATCH ELEVATOR OVERRUN GARAGE BELOW HOTEL BRIDGE RESIDENTIAL Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 4/5/2017 2:57:50 PMC:\Projects\PLACE_PUD-Resp-03_Site_shqipe@msrdesign.com.rvtA209 SOUTH BLDG HOTEL & RESIDENTIAL FLOOR PLANSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017/04/05 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 04/05/2017 PUD REVISION 03 03/07/2017 PUD RESPONSE 02 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 N 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE 1/16" = 1'-0"A209 1 ROOF PLAN City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 76 'A' SOUTH BUILDING SOUTH ELEVATION PLACE ST.LOUIS PARKDrawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.ST. LOUIS PARK, MN tel 100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE PUD Submission MD1101500 Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 DATEMARK DESCRIPTION tel 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 A210 SOUTH BLDG ELEVATIONS 1 1/16" = 1' - 0"A210 FIRST FLOOR 0' SECOND FLOOR 17'-0" THIRD FLOOR 27'-0" (T.O. PODIUM) FOURTH FLOOR 38'-8" FIFTH FLOOR 50'-4" SIXTH FLOOR 62'-0" ROOF 73'-8"17'-0"10'-0"11'-8"11'-8"11'-8"11'-8"BASEMENT -15'-0"15'-0"CAFE NAME SOUTH PLACE 0000 L/W SIGNAGE 0000 L/W SIGNAGE 0000 L/W SIGNAGE 0000 0000 0000 T.O. PARAPET 78'-8"5'-0"DOAS (DEDICATED OUTDOOR AIR SYSTEM) UNIT METAL SCREEN (TYP) PHOTOVOLTAIC PANELS (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) GREEN WALL (TYP)FORESHORTENED EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) EXT ENTRY LIGHT (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) BUILDING ADDRESS (TYP)VTAC GRILLE (TYP)ARTWORK DISPLAY AREA (TYP)ELEVATION 'D' SOUTH BUILDING EAST ELEVATION4 1/16" = 1' - 0"A210 'C' SOUTH BUILDING NORTH ELEVATION3 1/16" = 1' - 0"A210 FIRST FLOOR 0' SECOND FLOOR 17'-0" THIRD FLOOR 27'-0" (T.O. PODIUM) FOURTH FLOOR 38'-8" FIFTH FLOOR 50'-4" SIXTH FLOOR 62'-0" ROOF 73'-8"17'-0"10'-0"11'-8"11'-8"11'-8"11'-8"BASEMENT -15'-0"15'-0"T.O. PARAPET 78'-8"5'-0"ENDURAMAX BRICK (TYP)METAL PARKING SCREEN (TYP)METAL ARTWORK DISPLAY PANEL (TYP) ARTWORK DISPLAY AREA (TYP) DOAS UNIT METAL SCREEN (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ARTWORK & BALCONY LIGHTING (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) FIRST FLOOR 0' SECOND FLOOR 17'-0" THIRD FLOOR 27'-0" (T.O. PODIUM) FOURTH FLOOR 38'-8" FIFTH FLOOR 50'-4" SIXTH FLOOR 62'-0" ROOF 73'-8"17'-0"10'-0"11'-8"11'-8"11'-8"11'-8"BASEMENT -15'-0"15'-0"0000COWORKING HUBL/W SIGNAGE 0000 L/W SIGNAGE 0000 FUTURE LIGHT RAIL STATION ACCESS ROAD T.O. PARAPET 78'-8"5'-0"DOAS UNIT METAL SCREEN (TYP) VTAC GRILLE (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ENDURAMAX BRICK (TYP) ARTWORK & BALCONY LIGHTING (TYP) FORESHORTENED ARTWORK DISPLAY AREA (TYP) EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) EXT ENTRY LIGHT (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) BUILDING ADDRESS (TYP)ELEVATION FIRST FLOOR 0' SECOND FLOOR 17'-0" THIRD FLOOR 27'-0" (T.O. PODIUM) FOURTH FLOOR 38'-8" FIFTH FLOOR 50'-4" SIXTH FLOOR 62'-0" ROOF 73'-8"17'-0"10'-0"11'-8"11'-8"11'-8"11'-8"BASEMENT -15'-0"15'-0"ENTRYEXIT T.O. PARAPET 78'-8"5'-0"ENDURAMAX BRICK (TYP)METAL PARKING SCREEN (TYP)METAL ARTWORK DISPLAY PANEL (TYP) ARTWORK DISPLAY AREA (TYP) DOAS UNIT METAL SCREEN (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) NICHIHA GUNSMOKE RIBBED METALLIC PANEL (TYP) ARTWORK & BALCONY LIGHTING (TYP) ALUMINUM BALCONY COLOR TO MATCH WINDOW FRAMES (TYP) 'B' SOUTH BUILDING WEST ELEVATION2 1/16" = 1' - 0"A210 8'16'32' 1/16" = 1' - 0" GRAPHIC SCALE 0' A B C1 D2 ELEVATIONS LEGEND ARTWORK DISPLAY AREA BUILDING SIGNAGE AREA ART & BALCONY LIGHT EXT CANOPY MOUNTED CYLINDER DOWNLIGHT EXT ENTRY LIGHT LEGEND 1. SEE OTHER SUBMITTED SIGNAGE PACKAGE FOR ACTUAL HEIGHT AND AREA OF ALL BUILDING SIGNAGE. 2. SEE SUBMITTED DOCUMENT "POTENTIAL OPPORTUNITIES FOR LIVING ARTS IN PLACE COMMUNITIES", SPECIFICALLY THE "ARCHITECTURAL IMPLICATIONS" SHEET, FOR FURTHER DETAILS ON ARTWORK DISPLAY AREAS ON ELEVATIONS INDICATED ON THIS SHEET. NOTES FACES IN PUBLIC RIGHT OF WAY TRANSPARENT SURFACE ANALYSIS (SEE SHEET A211) C2 D1 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 77 'B' SOUTHWEST ELEVATION PLACE ST.LOUIS PARKDrawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.ST. LOUIS PARK, MN tel 100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-03-07 DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE PUD Submission MD1101500 Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 DATEMARK DESCRIPTION tel 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 A211 HOTEL ELEVATIONS 1 1/16" = 1' - 0"A211 'D' NORTHEAST ELEVATION3 1/16" = 1' - 0"A211 'F' EAST ELEVATION4 1/16" = 1' - 0"A211 FAIRFIELD MARRIOT0000 ELEVATION FIRST FLOOR (UPR) 3' SECOND FLOOR 18' (T.O. PODIUM) THIRD FLOOR 28'-9" FOURTH FLOOR 39'-6" FIFTH FLOOR 50'-3" SIXTH FLOOR 61'-0" FIRST FLOOR (LWR) 0'12'-0"BASEMENT -12'3'-0"15'-0"10'-9"10'-9"10'-9"10'-9"11'-3"ROOF 72'-3" T.O. PARAPET 75'-9"3'-6"FORESHORTENED NICHIHA GRAY ARCHITECTURALBLOCK (TYP) ENDURAMAX BRICK (TYP)BUILDING NUMBERS DOAS (DEDICATED OUTDOOR AIR SYSTEM) UNIT METAL SCREEN (TYP) PHOTOVOLTAIC PANELS (TYP) EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) EXT ENTRY LIGHT (TYP) COFFEE SHOP 0000 FIRST FLOOR (UPR) 3' SECOND FLOOR 18' (T.O. PODIUM) THIRD FLOOR 28'-9" FOURTH FLOOR 39'-6" FIFTH FLOOR 50'-3" SIXTH FLOOR 61'-0" FIRST FLOOR (LWR) 0'12'-0"BASEMENT -12'3'-0"15'-0"10'-9"10'-9"10'-9"10'-9"11'-3"ROOF 72'-3" T.O. PARAPET 75'-9"3'-6"FORESHORTENED ELEVATION DOAS UNIT METAL SCREEN (TYP) FAIRFIELD SIGNAGE EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) BUILDING ADDRESS NICHIHA GRAY ARCHITECTURALBLOCK (TYP) ENDURAMAX BRICK (TYP) COFFEE SHOP FAIRFIELD MARRIOT FIRST FLOOR (UPR) 3' SECOND FLOOR 18' (T.O. PODIUM) THIRD FLOOR 28'-9" FOURTH FLOOR 39'-6" FIFTH FLOOR 50'-3" SIXTH FLOOR 61'-0" FIRST FLOOR (LWR) 0'12'-0"BASEMENT -12'3'-0"15'-0"10'-9"10'-9"10'-9"10'-9"11'-3"ROOF 72'-3" T.O. PARAPET 75'-9"3'-6"R) FORESHORTENED ELEVATION DOAS UNIT METAL SCREEN (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) EXT ENTRY LIGHT (TYP) ENDURAMAX BRICK (TYP) CAFE NAME ELEVATION FIRST FLOOR (UPR) 3' SECOND FLOOR 18' (T.O. PODIUM) THIRD FLOOR 28'-9" FOURTH FLOOR 39'-6" FIFTH FLOOR 50'-3" SIXTH FLOOR 61'-0" ROOF 72'-3" FIRST FLOOR (LWR) 0'12'-0"BASEMENT -12'3'-0"15'-0"10'-9"10'-9"10'-9"10'-9"11'-3"T.O. PARAPET 75'-9"3'-6"ENDURAMAX BRICK (TYP) FORESHORTENED ARTWORK DISPLAY AREA (TYP) ARTWORK LIGHTING (TYP) EXT CANOPY MOUNTED CYLINDER DOWNLIGHT (TYP) DOAS UNIT METAL SCREEN (TYP) NICHIHA GRAY ARCHITECTURALBLOCK (TYP) EXT ENTRY LIGHT (TYP) 'C' NORTHWEST ELEVATION2 1/16" = 1' - 0"A211 8'16'32' 1/16" = 1' - 0" GRAPHIC SCALE 0' A ELEVATIONS LEGEND B C D1 E F G ARTWORK DISPLAY AREA BUILDING SIGNAGE AREA ART & BALCONY LIGHT EXT CANOPY MOUNTED CYLINDER DOWNLIGHT EXT ENTRY LIGHT LEGEND 1. SEE OTHER SUBMITTED SIGNAGE PACKAGE FOR ACTUAL HEIGHT AND AREA OF ALL BUILDING SIGNAGE. 2. SEE SUBMITTED DOCUMENT "POTENTIAL OPPORTUNITIES FOR LIVING ARTS IN PLACE COMMUNITIES", SPECIFICALLY THE "ARCHITECTURAL IMPLICATIONS" SHEET, FOR FURTHER DETAILS ON ARTWORK DISPLAY AREAS ON ELEVATIONS INDICATED ON THIS SHEET. NOTES FACES IN PUBLIC RIGHT OF WAY TRANSPARENT SURFACE ANALYSIS (SEE SHEET A211) D2 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 78 Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 1:18:07 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA212 SOUTH BUILDING ILLUSTRATIVE ELEVATIONSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 0 8 3216 1/16" = 1' - 0" GRAPHIC SCALE SOUTH ELEVATION - SUMMER RENDER1 A212 1/16" = 1' - 0" SOUTH ELEVATION - WINTER RENDER2 A212 1/16" = 1' - 0" City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 79 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 80 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 81 PLACE ST.LOUIS PARKDrawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.ST. LOUIS PARK, MN tel 100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-04-05 DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE PUD Submission MD1101500 Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: 02/24/2017 PUD RESPONSE 03/07/2017 PUD RESPONSE 02 DATEMARK DESCRIPTION tel 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 04/05/2017 PUD REVISION 03 A303 E-GEN ELEVATIONS 'C' NORTH ELEVATION1 1/8" = 1' - 0"A303 T.O.CO-GEN FLUE 39'-3" 0000 5 A303 FIRST FLOOR 0' SECOND FLOOR 10'-0" T.O.GREENHOUSE 19'-5" CISTERN -6' RAINWATER CATCHMENT CISTERN RAINWATER CATCHMENT CISTERN METAL PANEL SIDING NICHIHA GRAY ARCHITECTURALBLOCK FLUE GREENHOUSE GREENHOUSE FLUE SOLAR PANEL LOC'S BREAK OUT PANEL DOWNSPOUT (TYP) BUILDING ADDRESS SIGNAGE GLASS PANEL OVERHEAD DOOR (TYP) EXT ENTRY LIGHTOVERHEAD DOOR FIRST FLOOR 0' SECOND FLOOR 10'-0" T.O.GREENHOUSE 19'-5" T.O.CO-GEN FLUE 39'-3" CISTERN -6' RAINWATER CATCHMENT CISTERN FLUE GREENHOUSE METAL PANEL SIDING METAL STANDING SEAM ROOF FLUE SOLAR PANEL LOC'S NICHIHA GRAY ARCHITECTURAL BLOCK DOWNSPOUT (TYP) CHANNEL GLASS WALL SYST AND WINDOWS 'A' SOUTH ELEVATION2 1/8" = 1' - 0"A303 'D' EAST ELEVATION3 1/8" = 1' - 0"A303 4'8'16' 1/8" = 1' - 0" GRAPHIC SCALE 0' 'B' WEST ELEVATION4 1/8" = 1' - 0"A303 ELEVATIONS LEGEND A B C D TYPICAL CHANNEL GLASS WALL SYSTEM DETAIL5 NOT TO SCALEA303 A A303 A A303 B A303 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 82 Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 3:29:16 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA401 3D VIEWPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 VIEW TO SOUTH BUILDINGS FROM 36TH STREET1 A401 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 83 Drawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.tel DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: DATEMARK DESCRIPTION tel 2/24/2017 3:10:42 PMC:\Projects\PLACE_PUD-Resp-01_Site_natalya@msrdesign.com.rvtA501 ILLUSTRATIVE SECTIONSPLACE ST. LOUIS PARKST. LOUIS PARK, MN100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 PUD Submission MD1101500 02/24/2017 PUD RESPONSE 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 84 NORTH BUILDING TYPICAL SECTION PLACE ST.LOUIS PARKDrawing 2017 Copyright Meyer, Scherer & Rocastle, Ltd.ST. LOUIS PARK, MN tel 100 Portland Avenue South, Suite 100 Minneapolis, MN 55401 612 309 3889 2017-02-27 DRAWN BY:CHECKED BY: PROJECT NO. PROJECT PHASE PUD Submission MD1101500 Drawing 2017 Copyright Meyer, Scherer & Rockcastle, Ltd. ISSUE Signature: Print Names: Date:License No: 02/24/2017 PUD RESPONSE DATEMARK DESCRIPTION tel 2335 Highway 36 West Street St. Paul, MN 55113-3819 651 604 4861 A502 SECTIONS 1 1/8" = 1' - 0"A301 SOUTH HOTEL TYP SECTION AT LOBBY2 1/8" = 1' - 0"A301 SOUTH BLDG TYP SECTION4 1/8" = 1' - 0"A301 4'8'16' 1/8" = 1' - 0" GRAPHIC SCALE 0'60'-2"56'-8"10'-8"11'-6"10'-8"10'-8"13'-2"8'-3"8'-0"8'-0"8'-0"8'-0"9'-11"TOP OF PARAPET 24" WOOD TRUSS TYPICAL SPAN FROM HALLWAY TO OUTSIDE BEARING WALL 2X6 2 HOUR RATED PANELIZED WOOD WALL SYSTEM WITH 5" SPRAY FOAM 58" INTERIOR GYP SHEATHING, 58" DENSGLASS EXT SHEATHING, FLUID APPLIED WRB, 1 12" GRAPHITE EPS INSULATION WITH CLIPS, 58" NICHIHA RAINSCREEN UP TO 8" TAPERED RIGID INSULATION WITH MIN 4" RIGID INSULATION AT CENTER ROOF DRAINS WHITE 60 MIL TPO ON COVER BOARD 18" WOOD TRUSS TYPICAL SPANNING INTERIOR DEMISING WALL TO INTERIOR DEMISING WALL WITH 1" GYP TOPPING AND ACOUSTIMAT . TRUSSES FILLED WITH CHOPPED FIBERGLASS INSULATION TYPICAL 8' CEILING IN HALLWAYS RESERVED FOR DOAS DUCTWORK SYSTEM IN CORRIDOR ON 2X8 JOISTS SPANNING ON HALLWAY WALLS 2X6 2 HOUR RATED PANELIZED WOOD WALL SYSTEM WITH 5" SPRAY FOAM 58" INTERIOR GYP SHEATHING, 58" DENSGLASS EXT SHEATHING, FLUID APPLIED WRB, 2" EPS INSULATION WITH CLIPS, 2 14" ENDURAMAX BRICK RAINSCREEN TOP OF ROOF ROOF BEARING FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR GRADE 10'-9"18'-0"11'-3"9'-0"TOP OF ROOF SIXTH FLOOR FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR 9'-0"9'-0"9'-0"9'-0"10'-9"10'-9"10'-9"75'-9"72'-3"10'-9"15'-0"11'-3"9'-0"72'-9"69'-3"TOP OF ROOF SIXTH FLOOR FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR 9'-0"9'-0"9'-0"9'-0"10'-9"10'-9"10'-9"7'-6"7'-6"9'-0"7'-6"5'-0"9'-0"6'-10"7'-6"15'-0"11'-8"27'-0"10'-0"10'-0"10'-0"10'-0"77'-2"73'-8"TOP OF ROOF SIXTH FLOOR FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR 75'-9"72'-3"TOP OF ROOF SIXTH FLOOR FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR 11'-8"11'-8"11'-8"7'-6"7'-6"9'-0"7'-6"2'-11"9'-0"7'-5"9'-0"7'-5"9'-0"7'-5"9'-0"7'-6"25'-4"8'-10"7'-4 3/4"7'-4 7/8"7'-5"8'-10 3/4"7'-6"7'-6"15'-0"11'-8"27'-0"10'-0"10'-0"10'-0"10'-0"77'-2"73'-8"TOP OF ROOF SIXTH FLOOR FIFTH FLOOR FOURTH FLOOR THIRD FLOOR SECOND FLOOR FIRST FLOOR 11'-8"11'-8"11'-8"SOUTH BLDG TYP SECTION5 1/8" = 1' - 0"A301 SOUTH HOTEL TYP SECTION AT CAFE3 1/8" = 1' - 0"A301 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 85 >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > > > l lllllllllllllllllllllllll l l l l l l l l llllllll l l l l l l >>>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >> >>>> >> >> >>> >>> >> >> FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFMFMFMFMFM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFMFMFMFMFM>> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > > > > > > > > > >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>lllllllllllllllllllllllllllllllllllllllllllll l l l l l l lllllllll l l l l l l l l l l l l l l l l l l l l l l l l llllllllllllllllllllllllllllllllll l l l l l l l l l l l l l l llllllllllllllllllllllll lll l l l l l l l l l l l l l llllllll l lllll llllllll6" WM6" WM6" WM 12" WM 12" WM 8" WM 8" WM 8 " WM 6" WM 6" WM 12" WM 12" WM 12" WM 8 " W M >>>>>>>>>>>>>>>>SS SSSSSSSS SS SS SS >>>>>>>>>>>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >> >>>> >> >> >>> >>> >> >> >> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>FO-B FO-B FO-B FO-B FO-B FO-BFO-BFO-BFO-BFO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-BFO- B FO-BFO-BFO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-BG- B OHPOHPOHPFO-BFO-BFO -B FO -B F O - B FO-B FO-B FO-B FO-B O H P FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-B FO-BFO-B FO-B OHPOHPOHPOHPOHPOHPOHPOHPOHP OHP OHP OHP OHP OHP OHP OHPOHP W 36TH STREET YOSEMITE AVE SXENWOOD AVE SW 35 TH STREET CEDAR L A K E T R AI L WO O D D A L E A V E S MN 7 S E R VI C E R D EB HIG H W A Y 7 O N- R A M P llllllllllllllllll lllllllllllll l l l lS S S C-3 C-2/B-2 C-7/B-7 C-8 C-11 C-1 C-9 C-4 C-5 C-6 C-10 C-12/B-12 BENCHMARK TOP NUT HYDRANT ELEV=913.01 R 27B65 SE, EV. 922.088 >>>>l l l l l l l l l l >>>llllllll>>>>llllllllllllllll>>STORM SEWER STRUCTURE TREE BITUMINOUS PAVEMENT STORM SEWER REMOVALS LEGEND >>S CONCRETE SIDEWALK/PAVEMENT BUILDING>>SANITARY SEWER CURB AND GUTTER WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C001 EXISTING CONDITIONS AND REMOVALS 1 KEYNOTES: REMOVE SANITARY SERVICE. BULKHEAD AT MANHOLE. REMOVE STORM SEWER AND CULVERT REMOVE LIGHT POLE REMOVE FLAG POLE REMOVE OVERHEAD POWER LINE, TRANSFORMERS, AND POLES REMOVE BURIED GAS LINE SALVAGE AND RELOCATE LIGHT POLE SALVAGE AND PROTECT LIGHT POLE REMOVE LANDSCAPE ISLAND REMOVE BUILDING WATER SERVICE LINE TO WATERMAIN AND PLUG AT W.M. APPROXIMATE SERVICE LOCATION SHOWN, VERIFY IN FIELD. REMOVE AND SALVAGE ALL BENCHES, BODY BENCHES, BIKE RACKS, AND WASTE RECEPTACLES REMOVE BOLLARDS RELOCATE FIBER OPTIC CABLE 1 2 3 4 5 6 7 22 2 3 33 5 6 4 8 3 3 3 7 7 7 7 8 8 8 9 9 9 9 10 10 10 7 7 7 7 8 11 11 12 12 04080 N 10 13 13 21711 DAVID A. AHRENS PROFESSIONAL ENGINEER City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 86 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C101 SITE PLAN - OVERALL 04080 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT SITE DATA EXISTING PROPOSED TOTAL SITE AREA 6.94 ACRES 5.25 ACRES ZONING CLASSIFICATION: NORTH I-G (GENERAL INDUSTRIAL) PUD SOUTH C-2 (GENERAL COMMERCIAL) PUD PARKING DATA NORTH SOUTH TOTAL OFF-STREET SURFACE 56 4 60 ON-STREET 61 0 61 OFF-STREET STRUCTURED 99 227 326 TOTAL STALLS 216 231 447 DORA NORTH SOUTH TOTAL URBAN FOREST 33,560 0 33,560 ROOFTOP SPACES 735 728 1,463 SHARED BALCONIES 1,376 0 1,376 PERFORMANCE GATHERING 0 424 424 DOG RUN 0 752 752 TOTAL DORA 35,671 1,904 37,575 (16.4%) City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 87 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C102 SITE PLAN - NORTHWEST C104 SEE SH E E T C103SEE SHEET02040 N NOTES: 1. STRIPING COLORS SHALL CONTRAST WITH THE PAVEMENT SURFACE OR AS SPECIFIED BY LOCAL CODES. 2. REFER TO DETAIL SHEET FOR SIGN MOUNTING DETAIL. VAN 8.0'8.0'SEE SITE PLANFOR DIMENSION6" WHITE (TYP.) INCLUDE "VAN" FOR VAN ONLY STALLS AS NOTED ON THE SITE PLAN R7-8m AND R7-8bP (FOR ALL ACCESSIBLE STALLS). 45° 4" WIDE STRIPING @ 2'-0" SPACING. 90° ACCESSIBLE PARKING STALL STRIPING NO SCALE UNMARKED DISTANCE 6' MIN. 1.75' 2.5'24'CROSSWALK MARKING NO SCALE 2' DETAIL P-2 DETAIL P-1 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 88 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C103 SITE PLAN - NORTHEAST C104 SEE SH E E TC102SEE SHEET02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 89 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C104 SITE PLAN - SOUTH C102 SEE SH E E T 02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 90 >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >> >> >>>> >> >> >>>>>>>>SAN MH 30 I=172.85 (AS-BUILT 422S) (883.15 ADJ.) SAN MH 29 I=172.57 (AS-BUILT 422S) (882.87 ADJ.) SAN MH 28 I=186.56 (9" W AS-BUILT 422S) (896.86 ADJ.) I=174.00 (9" E AS-BUILT 185) (884.30 ADJ.) I=172.38 (AS-BUILT 422S) SAN MH I=185.75 (AS-BUILT 39S) (896.05 ADJ.) SAN MH I=186.79 (AS-BUILT 39S) (897.09 ADJ.) SAN MH I=187.91 (AS-BUILT 39S) (898.21 ADJ.) SAN MH I=175.00 (AS-BUILT 185S) (885.30 ADJ.) SAN MH I=176.00 (AS-BUILT 185S) (886.30 ADJ.) SAN MH R=911.98 I=896.42 E I=896.38 W SAN MH R=910.23 I=897.05 SAN MH R=906.87 I=897.85 S I=897.72 N SAN MH R=910.57 I=899.69 SW I=899.67 NE SAN MH R=900.63 I=894.25 SAN MH R=899.84 I=894.46 S I=893.71 W I=893.69 E > > > > > > > > > > > > > > > > >>>>>>> > > > > > > > > > > >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>C - B OHPOHPOHPOHPOHPOHPOHPOHPOHP OHP OHP OHP OHP OHP OHP OHPOHP W 36TH STREET YOSEMITE AVE SXENWOOD AVE SW 35 TH STREET CEDAR L A K E T R AI L WO O D D A L E A V E S MN 7 S E R VI C E R D EB HIG H W A Y 7 O N- R A M P S S S FFE 917.03 FFE 914.33 FFE 911.5 FFE 913.5 FFE 917.0 FFE 914.38 FFE 914.34 FFE 915.34 FFE 915.84 C301 GRADING AND DRAINAGE PLAN - OVERALL 21711 DAVID A. AHRENS PROFESSIONAL ENGINEER 04080 N NOTES: 1. SEE SHEETS C001 AND C003 FOR REMOVALS AND PRESERVATION PLANS. 2. THE CONTRACTOR IS SPECIFICALLY CAUTIONED THAT THE LOCATION AND/OR ELEVATION OF EXISTING UTILITIES AS SHOWN ON THESE PLANS IS BASED ON RECORDS OF THE VARIOUS UTILITY COMPANIES, AND WHERE POSSIBLE, MEASUREMENTS TAKEN IN THE FIELD. THE INFORMATION IS NOT TO BE RELIED ON AS BEING EXACT OR COMPLETE. THE CONTRACTOR SHALL VERIFY THE FIELD LOCATION OF ALL PUBLIC AND PRIVATE UTILITIES PRIOR TO CONSTRUCTION. THE CONTRACTOR SHALL CONTACT GOPHER STATE ONE CALL AT (651) 454-0002. IT SHALL BE THE RESPONSIBILITY OF THE CONTRACTOR TO RELOCATE ALL EXISTING UTILITIES WHICH CONFLICT WITH THE PROPOSED IMPROVEMENTS SHOWN ON THE PLANS. 3. ALL CUT OR FILL SLOPES SHALL BE 3:1 OR FLATTER UNLESS OTHERWISE NOTED. 4. EXISTING GRADE CONTOUR INTERVALS SHOWN AT 1 FOOT INTERVALS. 5. PROPOSED GRADE CONTOUR INTERVALS SHOWN AT 1 FOOT INTERVALS. 6. THE CONTRACTOR SHALL ADHERE TO ALL TERMS & CONDITIONS AS OUTLINED IN THE GENERAL N.P.D.E.S. PERMIT FOR STORMWATER DISCHARGE ASSOCIATED WITH CONSTRUCTION ACTIVITIES. 7. TOPOGRAPHIC INFORMATION TAKEN FROM A TOPOGRAPHIC SURVEY BY LAND SURVEYORS, IF CONTRACTOR DOES NOT ACCEPT EXISTING TOPOGRAPHY AS SHOWN ON THE PLANS, WITHOUT EXCEPTION, HE SHALL HAVE MADE, AT HIS EXPENSE, A TOPOGRAPHIC SURVEY BY A REGISTERED LAND SURVEYOR AND SUBMIT TO THE OWNER FOR REVIEW. 8. THE CONTRACTOR SHALL CONTACT ST LOUIS PARK SURFACE WATERS AND SEWERS 48 HOURS PRIOR TO ANY EXCAVATION OR CONSTRUCTION RELATED TO OR IN THE LOCATION OF THE PROPOSED STORMWATTER MANAGEMENT BMP. 9. UPON THE PROJECT'S COMPLETION THE CONTRACTOR SHALL PROVIDE TO THE DEPARTMENT OF PUBLIC WORKS A FINAL STORM WATER MANAGEMENT REPORT INCLUDING RECORD DRAWINGS. THE REPORT WILL SERVE AS A MEANS OF VERIFICATION THAT THE INTENT OF THE APPROVED STORMWATER MANAGEMENT DESIGN HAS BEEN MET. THIS FINAL REPORT SHALL SUBSTANTIATE THAT ALL ASPECTS OF THE ORIGINAL DESIGN HAVE BEEN ADEQUATELY PROVIDED FOR THE THE CONSTRUCTION OF THE PROJECT. 10. PROTECT EXISTING FORCE MAIN AS DIRECTED BY THE CITY OF ST LOUIS PARK. 11. REFER TO MPCA APPROVED RESPONSE ACTION PLAN FOR ADDITIONAL REQUIREMENTS. WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 91 >>>>>>>>>>>>>>> > >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > > > l lllllllllllllllllllll ll l l l llllllll l l l l l l >>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >>>>>>>> >> >>> >>> >> >> > F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M FMFMFMFMFMFM FM FM FM F M F M F M F M F M F M F M F M F M F M F M F M F M F M FF M F M F M F M F M F M F M F M F M F M F M F M F M F M FM FM FM FM FMFMFMFMFMFM>> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > >> > > > > > > > > > > > > > > > >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>ll l l ll l lllllllllllllllllllllllllll l l ll ll lllll l l l l l l lllllllll l l l l l l l l l l l l l l l l l l l l l l l l lllllllllllllllllllllllllllll l l l l l l l l l l l l l llllllllllllllllllllllll lll l l l l l l l l l l l l l llllll l l l lllll llllllll6"WM6" WM 6"WM 1 2 "W M 1 2 "W M 8 "W M 8 "W M 8 "WM6"WM 6 " W M 12"WM 12"WM 12"WM 8 "WM >>>>>>>>>>>>>>>>SS SSSSSSS SS SS SS >>>>>>>>>>>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >>>>>>>> >> >>> >>> >> >> > >> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >> >> >> >> >> >>>>>>E -B E -B E -B E -B E -B E -B E -B E-BE-BE-BE-BFO -B F O -B F O -B F O -B F O -B E-BC -B E-B E-BE-BE-BE-BE-BE-BE -B E-BE-BE -B E -B E -B E -B E -B E -B E -B E-BF O -B E-B FO-BF O-BF O-BF O -B F O -B F O -B F O -B F O -B E - B E - B E-BO H P F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B OHPOHPOHPOHPOHPOHPOHPOHPOHP OHP OHP OHP OHP OHP OHP OHPOHP W 36TH STREET YOSEMITEAVESXENWOODAVESW 35 TH STREET C E D A R L A K E T R A IL WO O D D A L E A V E S M N 7 S E R V IC E R D E B H IG H W A Y 7 O N -R A M P llllllllllllllllll lllllllllllll l l l lS S S C-3 C-2/B-2 C-7/B-7 C-8 C-11 C-1 C-9 C-4 C-5 C-6 C-10 C-12/B-12 C10C10 666BB >llllF M F M F M F M M F M F M F M F M M F M F M >>>>>>FF MM F M F M F M F M F MM F FF MMM EEBOHP C-4 66lllFM -BB EEF OEBEBC B - B 2/B2 F MM F M F M F M F M FF FFF MMM FF MMM F MMM >>lll>F M F M FFFF MMM F M F M E OH H P l FFFFFMMMMM E -B O BBBBOOOOB > > S >>>>>>>>>>>F M >>>>>>>>>FM >>FMFM >>>>>>>>>l>>>>>>>>>>>>>>>>>>SS >>>>>>>>>>>>>>>> > > > > > M SSSS > > >>>>>>l lll>llllllllllllllllllllll l lllllllF l l l l l l l >>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >>>>>>>> >> >>> >>> >> >> > F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M F M B F M F M F M F M F M FMFMFMFMFMFM >>>>>>FM FM FM F M F M F M F M F M F M F M F M F M F M F M F M F M F M FF M F M F M F M F M >>ll F M F M F M F M F M F M F M F M F M FM FM FM FM FMFMFMFMFMFM>> >> >> >> >> >> >> >> >> >>OHHPPPPPPO B--7- > l l >>>>>>>>>>M >>>>>>l>>>>>l>>>SS SS >>>>>>>>SS S >>>>>>>>>SS SSS >>>>>>>SSSSSSSSSSSSSSSSS SS >>>>>>SS SS > > > > > SSS > > > > > > > > SSS >>>>l>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>llllll>>>>>>>>lllllllllllllllllllllllllllllllllllllll l l l l l l >>lllllllll l l l l l l l l l l l l l l >l l l l l l l l l l lllllllllll ll>>llllllllllllllllll l l l l l l l l l l l l l lllllllSSSllll llllllllXElWOODlAVAESlllllll lll l l l l l l l l l l l l l >llllllll l lllll llllllll6"WM6" WM 6"WM 1 2 "W M 1 2 "W M 8 "W M 8 "W M 8 "WM6"WM 6 " W M 12"WM 12"WM 12"WM 8 "WM >>>>>>>>>>>>>SSS >>>SS SSSSSSSS SS SS SS HPPHPP>>>>>>>>>>>>>>>>>P >>>>>>>>>>>>>>>> >> >> >>>>> >> l >> >>>>>> >> > >ll>> >> >> >> >> >> >> >> >> >> >> >>>>>>>> >> >>> >>> >> >> > >> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>S >>>>>>>>>>>>>>>>S >>>>ll>>>>>>>>>>>>S >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>O>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>SSSSSS POH HPOOHPO OOHP121 E -B E -B E -B E -B E -B E -B E -B E-BE-BE-BE-BB FO -B F O F O -B F O F O -B F O F O -B F O F O -B EE-BFF O B BBBOBB B C -B FF OOOB E-B E-BE-BE-BE-BE-BE-BE -B E-BE-BE -B E -B E -B E -B E -B E -B E -B E-B>> ll >>>>>>>> >>>>>>>>>>>>>> >>>>>>>>>>>>>> >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>F O -B FFFFOO >>> > >>>>>> E-B FO-BF O-BMMMMMMM FF MM F O-BC --BB F O -B OO --BB F O -B OO --BB F O -B OO --BB F O -B OO --BB F O -B FFFFFFBBBBBBFFBBFF E - B E - B BBE-BBBBBBBB O H P OO EE FF OO llll>>>>>lllllllllllllllPPP >>>>>>>>lllllllllllF O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B F O -B OHPOHPOHPOHPOHPOHPOHPOHPOHP OHP OHP OHP OHP OHP OHP OHPOHP W 36TH STREET YOSEMITEAVESXENWOODAVESW 35 TH STREET C E D A R L A K E T R A IL WO O D D A L E A V E S M N 7 S E R V IC E R D E B H IG H W A Y 7 O N -R A M P llllllllllFF l>>>lllllll ll>>>>>>>lWWMMl>>>>>>>llllWWMM l1122 llll l l l lS S S C-3 C-2/B-2 C-7/B-7 C-8 C-11 C-1 C-9 C-4 C-5 C-6 C-10 C-12/B-12 MMMMMFFMMMMMMMMMM FFFFFFFFFFMMMMMMMMMMMMMMMMMM FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>FF>>>> >> >> >> >> >>>> >> >> >>>>>>>>SAN MH 30 I=172.85 (AS-BUILT 422S) (883.15 ADJ.) SAN MH 29 I=172.57 (AS-BUILT 422S) (882.87 ADJ.) SAN MH 28 I=186.56 (9" W AS-BUILT 422S) (896.86 ADJ.) I=174.00 (9" E AS-BUILT 185) (884.30 ADJ.) I=172.38 (AS-BUILT 422S) (882.68 ADJ.) SAN MH I=185.75 (AS-BUILT 39S) (896.05 ADJ.) SAN MH I=186.79 (AS-BUILT 39S) (897.09 ADJ.) SAN MH I=187.91 (AS-BUILT 39S) (898.21 ADJ.) SAN MH I=175.00 (AS-BUILT 185S) (885.30 ADJ.) SAN MH I=176.00 (AS-BUILT 185S) (886.30 ADJ.) SAN MH R=911.98 I=896.42 E I=896.38 W SAN MH R=910.23 I=897.05 SAN MH R=906.87 I=897.85 S I=897.72 N SAN MH R=910.57 I=899.69 SW I=899.67 NE SAN MH R=900.63 I=894.25 SAN MH R=899.84 I=894.46 S I=893.71 W I=893.69 E >I=1 H 30 7 > >FF MM FF MM >FF MM >FF MM > EEEE > > > > > > > > > >>>>>>FFFMM>>>>FFFF>>FFMMMM FF> FF MMMMMMMMMM FF MM > FF MM >FF MM >FF MMMM >FF MM > FF MMMM >FF MM FFFF MMMMMM > >F MM > >MM FFFFFFFFMMFFMMFFMMFFFFFFFFMMMMFFFF >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>FFFFFFFFMMFFMMFFMMFFFFFFFFMMFF FF MMFFMMFFMMFFFFMMMM FFFFFFFFFFFFFFFFFFFFF MMMMMMMMMM >>>>>>F>>FFMMMMFFMM >>>>>>>>MMMM >>>>>>>>>>>>>>>>>>>>ll>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> ll ll BBBBBB OO HH PP----llll ll>>> >> EE BB EE BB EE BB EE BB EE EE BB EE BB EE BB EE EE BB EE BB EE BB EE BB EE BB EE BB EE BB EE BB EE EE BB EE BB EE BB EE BB EE llllllllllllllllllll llllll>>>>>>>>>>>>>>>>>>8 W388 WW 9 BB E .38 SAN 1.98 =89 I N M R= OO HH PP OO HH PP OO HH OO HH PP OO HH llllllll >>>>>>>>>>>>>>>>>>>>>>>>>>>>-->>>>>>>>BBBB>>>>>>>>>>>>>>>>>>>>>>>>>>>> H BBBBHH >>>>W .05 I MH OOHHOOHHPP >> ll llll ll llll OO HHHH PPPP BBEE BB EEEEEEEEEEE --BBBBBBBBBBBOO--BB89 23 979 EE BB SSSSSSS>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>EEEEBBEEEEEEEEEEEEEBBEEEEEEEEEBBEEEEBBEEEEEEEEEEBBEEEEEEEEEEBBEEEEEEEEE--EEBBEEEEEEEEEEBBEEEEEEEE--EEBBEEEEEEE>>EE--EEBBEEEEEEE--BB--llIIII N N N N MMMMMMHMHMHMMMMMMMMMMHMMM IIII N N N N MMMMMMMMMMMMMMMMM WW88 "">>>>>>>>>>>>>>>>>>>>>>>>>>>>>>llllllllll >>>>>>>>>>>>>>>>>>>>>>>>- BBBB ll ll ll FF MMM FFFF MMMMMMM ll ll llll>>>>ll>>>>>>>>> FF O >> >>> CC FFFFFFFFFF EEEEEEEE>>FFFF MMMM lllllllllllllllllllllllllllllllllllllllllllllllllllll l l l l l l l l l >>>llllllllllllll>>>>llllllllllllllll8 4 +0 0 8 5 +0 0 8 6 +0 0 8 7 +0 0 8 8 +0 0 8 9 +0 0 9 0 +0 0 91+0092+0093+009 4 +0 0 9 5 +0 0 9 6 +0 0 97+009 8 +0 0 99+00SAN MH 30 I=172.85 (AS-BUILT 422S) (883.15 ADJ.) SAN MH 29 I=172.57 (AS-BUILT 422S) (882.87 ADJ.) SAN MH 28 I=186.56 (9" W AS-BUILT 422S) (896.86 ADJ.) I=174.00 (9" E AS-BUILT 185) (884.30 ADJ.) I=172.38 (AS-BUILT 422S) (882.68 ADJ.) SAN MH I=185.75 (AS-BUILT 39S) (896.05 ADJ.) SAN MH I=186.79 (AS-BUILT 39S) (897.09 ADJ.) SAN MH I=187.91 (AS-BUILT 39S) (898.21 ADJ.) SAN MH I=175.00 (AS-BUILT 185S) (885.30 ADJ.) SAN MH I=176.00 (AS-BUILT 185S) (886.30 ADJ.) SAN MH R=911.98 I=896.42 E I=896.38 W SAN MH R=910.23 I=897.05 SAN MH R=906.87 I=897.85 S I=897.72 N SAN MH R=910.57 I=899.69 SW I=899.67 NE SAN MH R=900.63 I=894.25 SAN MH R=899.84 I=894.46 S I=893.71 W I=893.69 E H IG H W A Y 7 STANDAL PROPERTY FIRE SERVICE 6" X 8" WET TAP AND VALVE 75' - 6" PVC DOMESTIC SERVICE 2" X 8" WET TAP AND VALVE 2" CORP STOP 75' - 2" TYPE K COPPER FIRE SERVICE 8" X 8" TEE 8" GV 54' - 8" PVCDOMESTIC SERVICE 6" X 8" TEE 6" GV 54' - 6" HDPE HOT WATER SAN MH 1 RIM=906.3 INV=898.6868 LF-8" PVC SANITARY SERVICE @ 1.0% SCHEDULE 40 HOT WATER SUPPLY WITH INSULATION FIRE SERVICE 8" X 8" TEE 8" GV & BOX 56' - 8" PVC DOMESTIC SERVICE 6" X 8" TEE 6" GV & BOX 56' - 6" HDPE PVC SANITARY SERVICE 65 LF-6" SAN @ 2.0% INSTALL WYE FITTING AND RISER EX. INV=884.8 FIRE SERVICE 8" X 12" WET TAP AND VALVE 72' - 8" PVC DOMESTIC SERVICE 6" X 12" WET TAP AND VALVE 72' - 6" HDPE SAN MH 30 I=172.85 (AS-BUILT 422S) (883.15 ADJ.) SAN MH 29 I=172.57 (AS-BUILT 422S) (882.87 ADJ.) SAN MH 28 I=186.56 (9" W AS-BUILT 422S) (896.86 ADJ.) I=174.00 (9" E AS-BUILT 185) (884.30 ADJ.) I=172.38 (AS-BUILT 422S) (882.68 ADJ.) 1 94' 2 4" @ 0.1 2 % 2 3 2' 2 4 "@0.1 2 %1 5 8' 2 4 "@0.1 2 %SAN MH I=185.75 (AS-BUILT 39S) (896.05 ADJ.) 1 8 0 '9 "V C P @ 0 .4 % SAN MH I=186.79 (AS-BUILT 39S) (897.09 ADJ.) 3 2 5 '9 "V C P @ 0 .3 2 % SAN MH I=187.91 (AS-BUILT 39S) (898.21 ADJ.) 3 5 0 '9 "V C P @ 0 .3 2 % 2 7 5 '9 "V C P @ 0 .4 8 % SAN MH I=175.00 (AS-BUILT 185S) (885.30 ADJ.) 250'8"CIP @ 0.4% SAN MH I=176.00 (AS-BUILT 185S) (886.30 ADJ.) 256'8"CIP @ 0.4% 186'9"VCP @ 0.29% SAN MH R=911.98 I=896.42 E I=896.38 W SAN MH R=910.23 I=897.05 SAN MH R=906.87 I=897.85 S I=897.72 N SAN MH R=910.57 I=899.69 SW I=899.67 NE SAN MH R=900.63 I=894.25 SAN MH R=899.84 I=894.46 S I=893.71 W I=893.69 E F F E = 9 1 7.0 3 L F E = 8 9 9.2 2 FFE= 914.33 FFE=911.5 FFE=913.5 LFE=902.5 FFE=917.0 PVC SANITARY SERVICE 48 LF-6" SAN @ 2.0% INSTALL WYE FITTING AND RISER EX. INV=882.85 FFE=915.84FFE= 915.34 FFE= 914.34 FFE= 914.34 LFE=899.55 PVC SANITARY SERVICE 65 LF-6" SAN @ 2.0% INSTALL WYE FITTING AND RISER CONNECT TO EX. MANHOLE. INV=898.00 21 LF-8" PVC SANITARY SERVICE @ 1.0% 8" PVC SANITARY INV=898.89 PVC SANITARY SERVICE 34 LF-6" SAN @ 2.0% INSTALL WYE FITTING AND RISER EX. INV=899.8 FIRE SERVICE STAND PIPE RISER FIRE SERVICE STAND PIPE RISER FIRE SERVICE STAND PIPE RISER FIRE SERVICE STAND PIPE RISER REMOVE AND REINSTALL EX. FIRE HYDRANT WITH 3.5' EXTENSION ON END OF WATER SERVICE LINE. MATCH EXISTING PIPE SIZE AND MATERIAL. EX. FIRE HYDRANT EX. FIRE HYDRANT EX. FIRE HYDRANT EX. FIRE HYDRANT EX. FIRE HYDRANT NOTES: 1. THE CITY OF ST. LOUIS PARK UTILITIES DIVISION (952-924-2558) SHALL BE CONTACTED AT LEAST 48 HOURS PRIOR TO ANY WATER SHUT-OFFS, SEWER CONNECTIONS, EXCAVATIONS, OR OTHER WORK RELATED TO THE CITY'S UTILITY SYSTEM. THE CONTRACTOR SHALL ALSO BE RESPONSIBLE FOR PROTECTING THE EXISTING SANITARY SEWER AND STORM SEWER SYSTEM DURING CONSTRUCTION, INCLUDING THE COST OF REMOVING AND CLEANING OF ANY DEBRIS IN THE LINES BOTH DURING AND AFTER COMPLETION OF CONSTRUCTION. 2. TAPPING REQUIREMENTS: WATER TAPS WITH ONE-INCH CONNECTIONS SHALL HAVE A MINIMUM DISTANCE OF FIVE FEET BETWEEN TAPS WHEN TAPS ARE ON THE SAME SIDE OF THE WATER MAIN. ONE-INCH CONNECTIONS MADE ON OPPOSITE SIDES OF THE WATER MAIN REQUIRE A MINIMUM DISTANCE OF 18-INCHES. CONNECTIONS LARGER THAN ONE-INCH REQUIRE A MINIMUM DISTANCE OF FIVE FEET BETWEEN TAPS. A MINIMUM DISTANCE OF FIVE FEET IS REQUIRED BETWEEN THE TAP AND A HYDRANT TEE OR VALVES. A MINIMUM DISTANCE OF 2 FEET IS REQUIRED BETWEEN A TAP AND THE BELL OR FITTING. SCHEDULE 40 STEEL CASING PIPE EXTENDING MINIMUM 10 FEET ON EITHER SIDE OF LRT TRACKS BURIED MINIMUM 6' UNDER TRACKS. HYDRANT BY SWLRT PROJECT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISIONI HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay.The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C401 SANITARY SEWER AND WATERMAIN 21711 DAVID A. AHRENS PROFESSIONAL ENGINEER 04080 N City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 92 HIGHW A Y 7 >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > > > l lllllllllllllllllllllllll l llllllll l l l l l l >>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >> >>>>>> >> >>> >>> >> >> > FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFMFMFMFMFM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FM FMFMFMFMFMFM>> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> > > > > > > > > > > > > >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>lllllllllllllllllllllllllllllllllllllllllllll l l l l l l lllllllll l l l l l l l l l l l l l l l l l l l l l l l l llllllllllllllllllllllllllllllllll l l l l l l l l l l l l l llllllllllllllllllllllll lll l l l l l l l l l l l l l llllllll l lllll llllllll>>>>>>>>>>>>>>>>SS SSSSSSSS SS SS SS >>>>>>>>>>>> >> >> >> >> >> >> >>>>>> >> > > >> >> >> >> >> >> >> >> >> >> >> >> >>>>>> >> >>> >>> >> >> > >> >> >> >> >> >> >> >> >> >> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>OHPOHPOHPOHPOHPOHPOHPOHPOHP OHP OHP OHP OHP OHP OHP OHPOHP W 36TH STREET YOSEMITE AVE SXENWOOD AVE SW 35 TH STREET CEDAR L A K E T R AI L WO O D D A L E A V E S MN 7 S E R VI C E R D EB HIG H W A Y 7 O N- R A M P llllllllllllllllll lllllllllllll l l l lS S S XENWOOD AVE SSTANDAL PROPERTYlllllllllllllllllllllllllllllllllllllllllllllllllllll l l l l l l l l l >>>llllllllllllll>>>>llllllllll>>llllll>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >> >> >>>> >> >> >>>>>>>>STORMWATER FILTERER MANHOLE INV 896.18 (EX W) (DEMO) INV 890.01 (EX SE) INV 900.78 (EX) STORMWATER FILTERER MANHOLE CONSTRUCT MANHOLE OVER EX. STORM SERWER PIPE INV 906.97 (EX 24") > > > > > > > > > > > > > > > > >>>>>>> > > > > > > > > > > > >>SAN MH 30 I=172.85 (AS-BUILT 422S) (883.15 ADJ.) SAN MH 29 I=172.57 (AS-BUILT 422S) (882.87 ADJ.) SAN MH 28 I=186.56 (9" W AS-BUILT 422S) (896.86 ADJ.) I=174.00 (9" E AS-BUILT 185) (884.30 ADJ.) I=172.38 (AS-BUILT 422S) (882.68 ADJ.) SAN MH I=185.75 (AS-BUILT 39S) (896.05 ADJ.) SAN MH I=186.79 (AS-BUILT 39S) (897.09 ADJ.) SAN MH I=187.91 (AS-BUILT 39S) (898.21 ADJ.) SAN MH I=175.00 (AS-BUILT 185S) (885.30 ADJ.) SAN MH I=176.00 (AS-BUILT 185S) (886.30 ADJ.) SAN MH R=911.98 I=896.42 E I=896.38 W SAN MH R=910.23 I=897.05 SAN MH R=906.87 I=897.85 S I=897.72 N SAN MH R=910.57 I=899.69 SW I=899.67 NE SAN MH R=900.63 I=894.25 SAN MH R=899.84 I=894.46 S I=893.71 W I=893.69 E>>>>>STM MH R=906.60 I= 902.35 STM MH R=906.58 I= 903.18 1 5 " R C P 1 5 " R C P F F E = 9 1 7 . 0 3 L F E = 8 9 9 . 2 2 FFE= 914.33 FFE=911.5 FFE=913.5 LFE=902.5 FFE=917.0 FFE=915.84FFE= 915.34FFE= 914.34 FFE= 914.34 LFE=899.55 EX MH R=909.31 I=903.01 EX MH R=911.77 I=905.87 EX MH R=915.08 I=908.08 268 LF-24" RCP 266 LF-24" RCP GREEN ROOF - SEE LANDSCAPE PLANS GREEN ROOF - SEE LANDSCAPE PLANS GREEN ROOF - SEE LANDSCAPE PLANS 7,000 SF X 4' DEEP TREE TRENCH NOTE: THE CITY OF ST. LOUIS PARK UTILITIES DIVISION (952-924-2558) SHALL BE CONTACTED AT LEAST 48 HOURS PRIOR TO ANY WATER SHUT-OFFS, SEWER CONNECTIONS, EXCAVATIONS, OR OTHER WORK RELATED TO THE CITY'S UTILITY SYSTEM. THE CONTRACTOR SHALL ALSO BE RESPONSIBLE FOR PROTECTING THE EXISTING SANITARY SEWER AND STORM SEWER SYSTEM DURING CONSTRUCTION, INCLUDING THE COST OF REMOVING AND CLEANING OF ANY DEBRIS IN THE LINES BOTH DURING AND AFTER COMPLETION OF CONSTRUCTION. WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C402 STORM SEWER PLAN 21711 DAVID A. AHRENS PROFESSIONAL ENGINEER 04080 N City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 93 #5 REBAR @ 16" O.C. EACH WAY EACH FACE. MINIMUM 3" COVER OVER REBAR. OVERLAP SPLICES AT CORNERS 18" MIN. 14" RAD TYP. ALL EXPOSED CORNERS AND EDGES UNDISTURBED OR COMPACTED SUBGRADE 12" COMPACTED GRANULAR BASE CONCRETE WALK6"18"1'PLANTING AREA 3" DEEP RECESS FOR INLAID ARTWORK PANEL BY OTHERS. SLOPE BOTTOM OF RECESS TO DRAIN. #4 REBAR WITH #3 HOOK TIES @ 36" O.C. 14" RAD TYP. ALL EXPOSED CORNERS AND EDGES UNDISTURBED OR COMPACTED SUBGRADE 12" COMPACTED GRANULAR BASE CONCRETE WALK6"8" (TYP)1'PLANTING AREA POURED-IN-PLACE CONCRETE CURB. CONTRACTION JOINTS AT 6'-0" SPACING & DOWELED EXPANSION JOINTS EVERY 24' 2 DOWELS PER EXPANSION JOINT WOOD FLOAT FINISH SLOPE TOP AT 14" PER FOOT TOWARD PLANTINGS 1'-6"6"6"8' WIDE BY 2.5' DEEP AGGREGATE SOIL TREE TRENCH. WRAP SIDES AND BOTTOM WITH EPDM LINER, AS SPECIFIED 3'-0"4' TO 7' (VARIES)8'-0" 4" HDPE DRAIN TILE IN FABIC SOCK TYP OF 2 ENTIRE LENGTH OF PLANTING AREA, CONNECT TO CATCH BASIN IN WOODDALE CONC. WALK 2'-6"PLANTING BED WITH PERENNIALS AND MULCH C801 SITE DETAILS WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C801 SITE DETAILS 21711 DAVID A. AHRENS PROFESSIONAL ENGINEER B PLANTER CURB NTS D NORTH BUILDING-RETAINING WALL AND SEATWALL BENCHES NTS CAST IN PLACE CONCRETE RETAINING WALL ARCHITECTURAL METAL RAILING CAST STONE ART WALLS A RAISED PLANTER WALL - ART INSET NTS C STORMWATER FILTRATION PLANTER-WOODDALE AVE NTS City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 94 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 L101 PLANTING PLAN - OVERALL 40002 STUART M. KRAHN LANDSCAPE ARCHITECT 04080 N TOTAL TREE/SHRUB COUNTS 244 - DECIDUOUS TREES 12 - CONIFEROUS TREES 8 - ORNAMENTAL TREES 422 - SHRUBS NOTES 1. SEE L8.01 FOR FULL PLANT SCHEDULE IRRIGATION NOTE: 1. ALL TURF, SEEDING AND PLANTING AREAS SHALL BE IRRIGATED WITH WATER EFFICIENT, 2. LOW PRECIPITATION RATE, ROTARY NOZZLE OVERHEAD SPRINKLER SYSTEMS. 3. NO DRIP IRRIGATION WILL BE ALLOWED. 4. IRRIGATION CONTROLLER SHALL BE 'SMART' WITH WEATHER BASED CONTROL. 5. IRRIGATION POC SHALL BE A SUB-METERED CONNECTION ON FROM THE PRIVATE UTILITY WATER SYSTEM. IRRIGATION MAINLINE SHALL BE BACKFLOW PROTECTED. EXTERNAL BACKFLOW ASSEMBLY SHALL BE LOCATED ON PRIVATE PROPERTY IN AN APPROVED ABOVE GROUND LOCKABLE VAULT BOX. IRRIGATION VAULT BOX AND POC E UIPMENT SHALL BE NEMA COMPLIANT. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 95 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 L102 PLANTING PLAN - NORTHWEST L104 SEE SH E E T L103SEE SHEET02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 96 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 L103 PLANTING PLAN - NORTHEAST L104 SEE SH E E TL102SEE SHEET02040 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 97 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 L104 PLANTING PLAN - SOUTH L102 SEE SH E E T 02040 N City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 98 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISIONI HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay.The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 PUD EXHIBIT 04080 N 40002 STUART M. KRAHN LANDSCAPE ARCHITECT City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 99 PLACE - ENVELOPE PROPOSALS NICHIHA Large Format High Performance Fiber Cement rain screen cladding system Fiber Cement Products* Brick Panels, Stone Panels, Block Panels, and Kurastone™ For Product Designation as Low VOC-Emitting Products in Accordance with the Following Standards: § LEED EQ Credit: Low-Emitting Materials for Building Design & Construction § Collaborative for High Performance Schools (2014 US-CHPS) EQ 7.1.6 § California Department of Public Health Standard Method V1.1 § Criteria for the MAS Certified Green® Program Fly Ash content Pre consumer 25% Wood Fibers Pre consumer 15% 2012 & 2015 IBC Section 1403.2 Section 1404.10 Section 1405.2 Section 1405.16 Section 1405.17 Architectural Wall Panels meet wind design pressures with installed wind clips. Meets or exceeds 2012 & 2015 IBC wind pressure requirements when tested in accordance with ASTM E 330-02 Architectural Wall Panels have 0 flame spread and 0 Smoke Development. Meets or exceeds ASTM C 1186-08 for Type A Grade II products 26 27 Whether you are an architect, a builder or a contractor, Nichiha wants to ensure that you have all the information you need to make your project go as smoothly as possible. The way we see it, we are partners. Our website offers a EQORTGJGPUKXGEQNNGEVKQPQHVGEJPKECNKPHQTOCVKQPKPUVCNNCVKQPXKFGQU#TEJKVGEVWTCNFGVCKNUKPFGRVJURGEKƂECVKQPU and everything you’ll ever need to know about installing Nichiha products. ƚŚĞƉŽǁĞƌŽĨƉŽƐƐŝďŝůŝƟĞƐTM Djg^c"]djhZiZX]c^XVaiZVb^h]ZgZid assist. If you have questions, comments or XdcXZgch!XVaajhVi&"-++")')"))'&dg email us at technicalservices@nichiha.com. is designed to support panel lateral stability, helping vertical joints stay tightly VÃi`°/ iÌ>LwÌë>Vii>ÃÞ>` is fastened to the Ultimate Clip with «ÀÛ`i`ÃVÀiÜ° No-fuss products. Little ongoing cleaning or regular maintenance needed. You get to bring your vision to life and ensure it looks great for a long time. The look you’re after, the performance we insist on. Never Underestimate the Power of REALLY GOOD TOOLS. Nichiha installation resources ensure optimal performance… Nichiha products are easy to install… you just need a few basic tools to get started.* CORRSOSION RESISTANT FLATHEAD SCREWS Take an even deeper dive and download our ^c"YZei]^chiVaaVi^dc\j^YZh# nichiha.com/resources/installation LViX]djg^chiVaaVi^dc^chigjXi^dchXdbZida^[Z¶ check out our installation videos today! nichiha.com/commercial/install Behind our Architectural Wall Panels is some SERIOUS TECHNOLOGY... www.nichiha.com City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 100 PLACE - ENVELOPE PROPOSALS NICHIHA ARCHITECTURAL BLOCK WOOD SIDING CONCRETE METALLIC STONES BRICK ILLUMINATIONS 18 X 72 18 X 120 18 X 120 18 X 120 18 X 72 18 X 72 TUSCAN BARK EMPIRE BLOCK MOTHER OF PEARL ALEXANDRIA BUFF CRIMSON MOCHA CEDAR INDUSTRIAL BLOCK GUNSMOKE WHITE WASH SHALE BROWNGRAY ANY COLOR 10 11 Get the clean lines you are after with our Modern Series >}`iÀ«ÃÃLiÜÌ Ì i«ÜiÀvwLiÀViiÌ The clean, modular look of Nichiha ArchitecturalBlock is a versatile choice for commercial and residential projects alike. Its cool modern tones and subtle seams are the perfect partner for gleaming glass, stainless steel or even paired with the warmth of wood. ArchitecturalBlock is a handsome, durable and cost-effective solution. The ease of installation and wide variety of corner options make it as popular with contractors as it is with clients. 6WHH$NQEMQHHGTUOCP[QHVJGUCOGHGCVWTGUCU#TEJKVGEVWTCN$NQEMDWVVCMGUOQFGTPVQVJGPGZVNGXGNYKVJKVUVQWIJVGZVWTGFƂPKUJ 6WHH$NQEMTGOCKPUVTWGVQKVUPCOGYKVJCUVTQPIEQPUVTWEVKQPVJCVKUDCEMGFD[VJGRQYGTQHƂDGTEGOGPV6JKURTQFWEVOGCPU DWUKPGUUCPFKUDWKNVVQNCUV6WHH$NQEMKUVJGRGTHGEV#TEJKVGEVWTCN9CNN2CPGNHQTJKIJVTCHƂECTGCUCUKVUVCPFUWRCICKPUVGXGT[FC[ wear and tear. The look you envisioned… the Performance you hoped for ARCHITECTURALBLOCK™ GRAY MOCHA TUSCAN MODERN SERIES www.nichiha.com Modern Design Tip: Add a touch of warmth to your modern design with our Wood Series. Learn more on Page 12! ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | VINTAGEWOOD | ILLUMINATION ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | GRAY TUFFBLOCK™ STEEL BAMBOO WALNUT PEWTER ARCHITECTURALBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16’ [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] *APPEARANCE AND TEXTURE MAY VARY BY COLOR TUFFBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] 10 11 Get the clean lines you are after with our Modern Series >}`iÀ«ÃÃLiÜÌ Ì i«ÜiÀvwLiÀViiÌ The clean, modular look of Nichiha ArchitecturalBlock is a versatile choice for commercial and residential projects alike. Its cool modern tones and subtle seams are the perfect partner for gleaming glass, stainless steel or even paired with the warmth of wood. ArchitecturalBlock is a handsome, durable and cost-effective solution. The ease of installation and wide variety of corner options make it as popular with contractors as it is with clients. 6WHH$NQEMQHHGTUOCP[QHVJGUCOGHGCVWTGUCU#TEJKVGEVWTCN$NQEMDWVVCMGUOQFGTPVQVJGPGZVNGXGNYKVJKVUVQWIJVGZVWTGFƂPKUJ 6WHH$NQEMTGOCKPUVTWGVQKVUPCOGYKVJCUVTQPIEQPUVTWEVKQPVJCVKUDCEMGFD[VJGRQYGTQHƂDGTEGOGPV6JKURTQFWEVOGCPU DWUKPGUUCPFKUDWKNVVQNCUV6WHH$NQEMKUVJGRGTHGEV#TEJKVGEVWTCN9CNN2CPGNHQTJKIJVTCHƂECTGCUCUKVUVCPFUWRCICKPUVGXGT[FC[ wear and tear. The look you envisioned… the Performance you hoped for ARCHITECTURALBLOCK™ GRAY MOCHA TUSCAN MODERN SERIES www.nichiha.com Modern Design Tip: Add a touch of warmth to your modern design with our Wood Series. Learn more on Page 12! ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | VINTAGEWOOD | ILLUMINATION ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | GRAY TUFFBLOCK™ STEEL BAMBOO WALNUT PEWTER ARCHITECTURALBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16’ [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] *APPEARANCE AND TEXTURE MAY VARY BY COLOR TUFFBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] 10 11 Get the clean lines you are after with our Modern Series >}`iÀ«ÃÃLiÜÌ Ì i«ÜiÀvwLiÀViiÌ The clean, modular look of Nichiha ArchitecturalBlock is a versatile choice for commercial and residential projects alike. Its cool modern tones and subtle seams are the perfect partner for gleaming glass, stainless steel or even paired with the warmth of wood. ArchitecturalBlock is a handsome, durable and cost-effective solution. The ease of installation and wide variety of corner options make it as popular with contractors as it is with clients. 6WHH$NQEMQHHGTUOCP[QHVJGUCOGHGCVWTGUCU#TEJKVGEVWTCN$NQEMDWVVCMGUOQFGTPVQVJGPGZVNGXGNYKVJKVUVQWIJVGZVWTGFƂPKUJ 6WHH$NQEMTGOCKPUVTWGVQKVUPCOGYKVJCUVTQPIEQPUVTWEVKQPVJCVKUDCEMGFD[VJGRQYGTQHƂDGTEGOGPV6JKURTQFWEVOGCPU DWUKPGUUCPFKUDWKNVVQNCUV6WHH$NQEMKUVJGRGTHGEV#TEJKVGEVWTCN9CNN2CPGNHQTJKIJVTCHƂECTGCUCUKVUVCPFUWRCICKPUVGXGT[FC[ wear and tear. The look you envisioned… the Performance you hoped for ARCHITECTURALBLOCK™ GRAY MOCHA TUSCAN MODERN SERIES www.nichiha.com Modern Design Tip: Add a touch of warmth to your modern design with our Wood Series. Learn more on Page 12! ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | VINTAGEWOOD | ILLUMINATION ARCHITECTURALBLOCK | GRAY ARCHITECTURALBLOCK | GRAY TUFFBLOCK™ STEEL BAMBOO WALNUT PEWTER ARCHITECTURALBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16’ [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] *APPEARANCE AND TEXTURE MAY VARY BY COLOR TUFFBLOCK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455MM [H] X 1,818MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] 12 13 WOOD SERIES Get the natural look of wood with the unmatched `ÕÀ>LÌÞvwLiÀViiÌ° Nichiha provides the look of wood without the drawbacks of natural wood cladding. Built to last, our VintageWood and 4QWIJ5CYPQHHGTVJGTKEJVGZVWTGUQHYQQFYJKNGRTQXKFKPIEQNQTUVCDKNKV[CPFYKVJUVCPFKPIGZVTGOGYGCVJGTGNGOGPVU 8KPVCIG9QQFGZWFGUOQFGTPTGƂPGOGPVCPFYQTMUYGNNKPDQVJOQFGTPCPFXKPVCIGFGUKIPU9KVJKVUGCTVJ[CRRGCN 4QWIJ5CYPCFFUTWUVKEUQRJKUVKECVKQPVQCNNV[RGUQHRTQLGEVU$QVJRTQFWEVURCKTRGTHGEVN[YKVJINCUUOGVCNCPF block panels, adding a touch of warmth to the coolness of these materials. 8KPVCIG9QQFCPF4QWIJ5CYPCTGCUXGTUCVKNGCUVJG[CTGFWTCDNG1WTWood Series panels can install both vertically and JQTK\QPVCNN[CPFECPDGWUGFKPKPVGTKQTCPFGZVGTKQTUGVVKPIU*KFFGPHCUVGPGTURTQXKFGCENGCPCPFDGCWVKHWNNQQM %TGCVKPIVJGRGTHGEVOCVEJ0KEJKJCIKXGU[QWVJGDGCWV[QHYQQFDCEMGFD[VJGDTCYPQHƂDGTEGOGPV Warmth, Sophistication, Endurance… What more could you ask for? www.nichiha.com VINTAGEWOOD™ BARK CEDAR VINTAGEWOOD™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] ROUGHSAWN™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Warm up your project with our Wood Series ROUGHSAWN™ ESPRESSO TOBACCO SMOKE NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR ROUGHSAWN | TOBACCO 14 15 Want the concrete look without the dimples? Check out our IndustrialBlock panel. CONCRETE SERIES IndustrialBlock and EmpireBlock put a fresh v>Vi`ÕÃÌÀ>V V° $CEMGFD[VJGRQYGTQHƂDGTEGOGPV+PFWUVTKCN$NQEMQHHGTUCFKUVTGUUGFEQPETGVGFGUKIPYKVJCNNVJGKTTGIWNCTKVKGUCPF characteristics of natural concrete. IndustrialBlock can pair with a wide range of products and its fresh approach works in both OQFGTPCPFXKPVCIGUGVVKPIU6JGNKIJVYGKIJVRCPGNUKPUVCNNXGTVKECNN[CPFJQTK\QPVCNN[EQXGTKPIUSWCTGHGGVRGTRCPGN EmpireBlock delivers the look and feel of precast concrete block in a more versatile and easier to use format. Perfect for indoor environments as well as exterior cladding, you will never have to worry about curing times, cracking or color inconsistency. www.nichiha.com FPO EMPIREBLOCK™ INDUSTRIALBLOCK™ EMPIREBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] INDUSTRIALBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] The Concrete Series… Perfectly imperfect in every way NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK 14 15 Want the concrete look without the dimples? Check out our IndustrialBlock panel. CONCRETE SERIES IndustrialBlock and EmpireBlock put a fresh v>Vi`ÕÃÌÀ>V V° $CEMGFD[VJGRQYGTQHƂDGTEGOGPV+PFWUVTKCN$NQEMQHHGTUCFKUVTGUUGFEQPETGVGFGUKIPYKVJCNNVJGKTTGIWNCTKVKGUCPF characteristics of natural concrete. IndustrialBlock can pair with a wide range of products and its fresh approach works in both OQFGTPCPFXKPVCIGUGVVKPIU6JGNKIJVYGKIJVRCPGNUKPUVCNNXGTVKECNN[CPFJQTK\QPVCNN[EQXGTKPIUSWCTGHGGVRGTRCPGN EmpireBlock delivers the look and feel of precast concrete block in a more versatile and easier to use format. Perfect for indoor environments as well as exterior cladding, you will never have to worry about curing times, cracking or color inconsistency. www.nichiha.com FPO EMPIREBLOCK™ INDUSTRIALBLOCK™ EMPIREBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] INDUSTRIALBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] The Concrete Series… Perfectly imperfect in every way NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK 14 15 Want the concrete look without the dimples? Check out our IndustrialBlock panel. CONCRETE SERIES IndustrialBlock and EmpireBlock put a fresh v>Vi`ÕÃÌÀ>V V° $CEMGFD[VJGRQYGTQHƂDGTEGOGPV+PFWUVTKCN$NQEMQHHGTUCFKUVTGUUGFEQPETGVGFGUKIPYKVJCNNVJGKTTGIWNCTKVKGUCPF characteristics of natural concrete. IndustrialBlock can pair with a wide range of products and its fresh approach works in both OQFGTPCPFXKPVCIGUGVVKPIU6JGNKIJVYGKIJVRCPGNUKPUVCNNXGTVKECNN[CPFJQTK\QPVCNN[EQXGTKPIUSWCTGHGGVRGTRCPGN EmpireBlock delivers the look and feel of precast concrete block in a more versatile and easier to use format. Perfect for indoor environments as well as exterior cladding, you will never have to worry about curing times, cracking or color inconsistency. www.nichiha.com FPO EMPIREBLOCK™ INDUSTRIALBLOCK™ EMPIREBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] INDUSTRIALBLOCK™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] The Concrete Series… Perfectly imperfect in every way NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK EMPIREBLOCK 12 13 WOOD SERIES Get the natural look of wood with the unmatched `ÕÀ>LÌÞvwLiÀViiÌ° Nichiha provides the look of wood without the drawbacks of natural wood cladding. Built to last, our VintageWood and 4QWIJ5CYPQHHGTVJGTKEJVGZVWTGUQHYQQFYJKNGRTQXKFKPIEQNQTUVCDKNKV[CPFYKVJUVCPFKPIGZVTGOGYGCVJGTGNGOGPVU 8KPVCIG9QQFGZWFGUOQFGTPTGƂPGOGPVCPFYQTMUYGNNKPDQVJOQFGTPCPFXKPVCIGFGUKIPU9KVJKVUGCTVJ[CRRGCN 4QWIJ5CYPCFFUTWUVKEUQRJKUVKECVKQPVQCNNV[RGUQHRTQLGEVU$QVJRTQFWEVURCKTRGTHGEVN[YKVJINCUUOGVCNCPF block panels, adding a touch of warmth to the coolness of these materials. 8KPVCIG9QQFCPF4QWIJ5CYPCTGCUXGTUCVKNGCUVJG[CTGFWTCDNG1WTWood Series panels can install both vertically and JQTK\QPVCNN[CPFECPDGWUGFKPKPVGTKQTCPFGZVGTKQTUGVVKPIU*KFFGPHCUVGPGTURTQXKFGCENGCPCPFDGCWVKHWNNQQM %TGCVKPIVJGRGTHGEVOCVEJ0KEJKJCIKXGU[QWVJGDGCWV[QHYQQFDCEMGFD[VJGDTCYPQHƂDGTEGOGPV Warmth, Sophistication, Endurance… What more could you ask for? www.nichiha.com VINTAGEWOOD™ BARK CEDAR VINTAGEWOOD™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] ROUGHSAWN™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Warm up your project with our Wood Series ROUGHSAWN™ ESPRESSO TOBACCO SMOKE NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR ROUGHSAWN | TOBACCO 12 13 WOOD SERIES Get the natural look of wood with the unmatched `ÕÀ>LÌÞvwLiÀViiÌ° Nichiha provides the look of wood without the drawbacks of natural wood cladding. Built to last, our VintageWood and 4QWIJ5CYPQHHGTVJGTKEJVGZVWTGUQHYQQFYJKNGRTQXKFKPIEQNQTUVCDKNKV[CPFYKVJUVCPFKPIGZVTGOGYGCVJGTGNGOGPVU 8KPVCIG9QQFGZWFGUOQFGTPTGƂPGOGPVCPFYQTMUYGNNKPDQVJOQFGTPCPFXKPVCIGFGUKIPU9KVJKVUGCTVJ[CRRGCN 4QWIJ5CYPCFFUTWUVKEUQRJKUVKECVKQPVQCNNV[RGUQHRTQLGEVU$QVJRTQFWEVURCKTRGTHGEVN[YKVJINCUUOGVCNCPF block panels, adding a touch of warmth to the coolness of these materials. 8KPVCIG9QQFCPF4QWIJ5CYPCTGCUXGTUCVKNGCUVJG[CTGFWTCDNG1WTWood Series panels can install both vertically and JQTK\QPVCNN[CPFECPDGWUGFKPKPVGTKQTCPFGZVGTKQTUGVVKPIU*KFFGPHCUVGPGTURTQXKFGCENGCPCPFDGCWVKHWNNQQM %TGCVKPIVJGRGTHGEVOCVEJ0KEJKJCIKXGU[QWVJGDGCWV[QHYQQFDCEMGFD[VJGDTCYPQHƂDGTEGOGPV Warmth, Sophistication, Endurance… What more could you ask for? www.nichiha.com VINTAGEWOOD™ BARK CEDAR VINTAGEWOOD™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] ROUGHSAWN™* AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Warm up your project with our Wood Series ROUGHSAWN™ ESPRESSO TOBACCO SMOKE NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR VINTAGEWOOD | CEDAR ROUGHSAWN | TOBACCO 8 9 9KVJKVURTGOKWOOGVCNNKENQQMKPIƂPKUJCPFWPKSWGVGZVWTGQWT4KDDGF2CPGNKUVJGRGTHGEVEQORNGOGPVVQCP[RTQLGEV6JG 4KDDGF2CPGNRTQXKFGUCITGCVUQNWVKQPVQDTGCMWRCURCEGCPFCFFUUQRJKUVKECVKQPVQVJGQXGTCNNFGUKIPCGUVJGVKE+VKURGTHGEVCU an exterior or interior accent and its sleek look pairs well with modern materials such as block panels, glass and metal. The panel HGCVWTGUCFGNWZGƂPKUJVJCVTGƃGEVUNKIJVCPFETGCVGUVJGCRRGCTCPEGQHDTWUJGFRTGEKQWUOGVCNU6JGTKDDGFVGZVWTGCNNQYUVJG RCPGNVQCFFKPVGTGUVCPFXCTKCVKQP6JG4KDDGF2CPGNKUGCUKN[KPUVCNNGFYKVJQWTVKOGUCXKPIENKRKPUVCNNCVKQPU[UVGOCPFJKFFGP fasteners help maintain a clean design. #TG[QWTGCF[VQOCMGCDKIDQNFXKUWCNKORCEVD[WVKNK\KPIVJG&SWCNKVKGUQHVJG4KDDGF2CPGN!+VKUUWTGVQVCMGEGPVGTUVCIGCPF stand out from the crowd. Turn up the volume and drama on your next project. RIBBED™ MOTHER OF PEARL GUNSMOKE METALLIC SERIES RIBBED - NEW AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Heavy metal is not just for the stage… it is also notorious for bringing walls to life NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY Unleash your inner rock star with thethe Rev it up! Add the Ribbed panel to your next focal wall.NOTE: THERE ARE 9 RIBS PER PANEL RIBBED | GUNSMOKE & MOTHER OF PEARL RIBBED | GUNSMOKE RIBBED | MOTHER OF PEARL RIBBED | MOTHER OF PEARL 18 19 BRICK SERIES Nichiha’s Brick Series offers the look and timeless appeal of traditional brickwork. The slight variations in color, the stately good looks, even the grout lines; it’s all there. Thanks to a proprietary multi-layered coating process, the beauty of Nichiha is built to last. We did leave out two things: the tons of weight and the extra time required to see your project to completion… but we ƂIWTGFVJG[YQWNFPoVDGOKUUGF All the things you love about brick The look you want…without the cost, without the hassle www.nichiha.com CANYONBRICK™ SHALE BROWN CANYONBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] PLYMOUTHBRICK™ CRIMSON PLYMOUTHBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] VINTAGEBRICK™ ALEXANDRIA BUFF WHITE WASH VINTAGEBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 3/4” (18 MM) WEIGHT (LBS. PER PANEL) 39.6 WEIGHT (LBS. PER SQ. FT.) 4.4 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] Get the classic look of `^acÃgZYWg^X`l^i] the modern strength of PlymouthBrick panels.PLYMOUTHBRICK | CRIMSON VINTAGEBRICK | ALEXANDRIA BUFF VINTAGEBRICK | WHITE WASH CANYONBRICK | SHALE BROWN 18 19 BRICK SERIES Nichiha’s Brick Series offers the look and timeless appeal of traditional brickwork. The slight variations in color, the stately good looks, even the grout lines; it’s all there. Thanks to a proprietary multi-layered coating process, the beauty of Nichiha is built to last. We did leave out two things: the tons of weight and the extra time required to see your project to completion… but we ƂIWTGFVJG[YQWNFPoVDGOKUUGF All the things you love about brick The look you want…without the cost, without the hassle www.nichiha.com CANYONBRICK™ SHALE BROWN CANYONBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] PLYMOUTHBRICK™ CRIMSON PLYMOUTHBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] VINTAGEBRICK™ ALEXANDRIA BUFF WHITE WASH VINTAGEBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 3/4” (18 MM) WEIGHT (LBS. PER PANEL) 39.6 WEIGHT (LBS. PER SQ. FT.) 4.4 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] Get the classic look of `^acÃgZYWg^X`l^i] the modern strength of PlymouthBrick panels.PLYMOUTHBRICK | CRIMSON VINTAGEBRICK | ALEXANDRIA BUFF VINTAGEBRICK | WHITE WASH CANYONBRICK | SHALE BROWN 18 19 BRICK SERIES Nichiha’s Brick Series offers the look and timeless appeal of traditional brickwork. The slight variations in color, the stately good looks, even the grout lines; it’s all there. Thanks to a proprietary multi-layered coating process, the beauty of Nichiha is built to last. We did leave out two things: the tons of weight and the extra time required to see your project to completion… but we ƂIWTGFVJG[YQWNFPoVDGOKUUGF All the things you love about brick The look you want…without the cost, without the hassle www.nichiha.com CANYONBRICK™ SHALE BROWN CANYONBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] PLYMOUTHBRICK™ CRIMSON PLYMOUTHBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] VINTAGEBRICK™ ALEXANDRIA BUFF WHITE WASH VINTAGEBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 3/4” (18 MM) WEIGHT (LBS. PER PANEL) 39.6 WEIGHT (LBS. PER SQ. FT.) 4.4 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] Get the classic look of `^acÃgZYWg^X`l^i] the modern strength of PlymouthBrick panels.PLYMOUTHBRICK | CRIMSON VINTAGEBRICK | ALEXANDRIA BUFF VINTAGEBRICK | WHITE WASH CANYONBRICK | SHALE BROWN 18 19 BRICK SERIES Nichiha’s Brick Series offers the look and timeless appeal of traditional brickwork. The slight variations in color, the stately good looks, even the grout lines; it’s all there. Thanks to a proprietary multi-layered coating process, the beauty of Nichiha is built to last. We did leave out two things: the tons of weight and the extra time required to see your project to completion… but we ƂIWTGFVJG[YQWNFPoVDGOKUUGF All the things you love about brick The look you want…without the cost, without the hassle www.nichiha.com CANYONBRICK™ SHALE BROWN CANYONBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] PLYMOUTHBRICK™ CRIMSON PLYMOUTHBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] VINTAGEBRICK™ ALEXANDRIA BUFF WHITE WASH VINTAGEBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 3/4” (18 MM) WEIGHT (LBS. PER PANEL) 39.6 WEIGHT (LBS. PER SQ. FT.) 4.4 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] Get the classic look of `^acÃgZYWg^X`l^i] the modern strength of PlymouthBrick panels.PLYMOUTHBRICK | CRIMSON VINTAGEBRICK | ALEXANDRIA BUFF VINTAGEBRICK | WHITE WASH CANYONBRICK | SHALE BROWN 18 19 BRICK SERIES Nichiha’s Brick Series offers the look and timeless appeal of traditional brickwork. The slight variations in color, the stately good looks, even the grout lines; it’s all there. Thanks to a proprietary multi-layered coating process, the beauty of Nichiha is built to last. We did leave out two things: the tons of weight and the extra time required to see your project to completion… but we ƂIWTGFVJG[YQWNFPoVDGOKUUGF All the things you love about brick The look you want…without the cost, without the hassle www.nichiha.com CANYONBRICK™ SHALE BROWN CANYONBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] PLYMOUTHBRICK™ CRIMSON PLYMOUTHBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 5/8” (16 MM) WEIGHT (LBS. PER PANEL) 35.2 WEIGHT (LBS. PER SQ. FT.) 3.9 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] VINTAGEBRICK™ ALEXANDRIA BUFF WHITE WASH VINTAGEBRICK™ AWP 1818 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] (455 MM [H] X 1,818 MM [L]) THICKNESS (ACTUAL MM) 3/4” (18 MM) WEIGHT (LBS. PER PANEL) 39.6 WEIGHT (LBS. PER SQ. FT.) 4.4 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] Get the classic look of `^acÃgZYWg^X`l^i] the modern strength of PlymouthBrick panels.PLYMOUTHBRICK | CRIMSON VINTAGEBRICK | ALEXANDRIA BUFF VINTAGEBRICK | WHITE WASH CANYONBRICK | SHALE BROWN 8 9 9KVJKVURTGOKWOOGVCNNKENQQMKPIƂPKUJCPFWPKSWGVGZVWTGQWT4KDDGF2CPGNKUVJGRGTHGEVEQORNGOGPVVQCP[RTQLGEV6JG 4KDDGF2CPGNRTQXKFGUCITGCVUQNWVKQPVQDTGCMWRCURCEGCPFCFFUUQRJKUVKECVKQPVQVJGQXGTCNNFGUKIPCGUVJGVKE+VKURGTHGEVCU an exterior or interior accent and its sleek look pairs well with modern materials such as block panels, glass and metal. The panel HGCVWTGUCFGNWZGƂPKUJVJCVTGƃGEVUNKIJVCPFETGCVGUVJGCRRGCTCPEGQHDTWUJGFRTGEKQWUOGVCNU6JGTKDDGFVGZVWTGCNNQYUVJG RCPGNVQCFFKPVGTGUVCPFXCTKCVKQP6JG4KDDGF2CPGNKUGCUKN[KPUVCNNGFYKVJQWTVKOGUCXKPIENKRKPUVCNNCVKQPU[UVGOCPFJKFFGP fasteners help maintain a clean design. #TG[QWTGCF[VQOCMGCDKIDQNFXKUWCNKORCEVD[WVKNK\KPIVJG&SWCNKVKGUQHVJG4KDDGF2CPGN!+VKUUWTGVQVCMGEGPVGTUVCIGCPF stand out from the crowd. Turn up the volume and drama on your next project. RIBBED™ MOTHER OF PEARL GUNSMOKE METALLIC SERIES RIBBED - NEW AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Heavy metal is not just for the stage… it is also notorious for bringing walls to life NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY Unleash your inner rock star with thethe Rev it up! Add the Ribbed panel to your next focal wall.NOTE: THERE ARE 9 RIBS PER PANEL RIBBED | GUNSMOKE & MOTHER OF PEARL RIBBED | GUNSMOKE RIBBED | MOTHER OF PEARL RIBBED | MOTHER OF PEARL 8 9 9KVJKVURTGOKWOOGVCNNKENQQMKPIƂPKUJCPFWPKSWGVGZVWTGQWT4KDDGF2CPGNKUVJGRGTHGEVEQORNGOGPVVQCP[RTQLGEV6JG 4KDDGF2CPGNRTQXKFGUCITGCVUQNWVKQPVQDTGCMWRCURCEGCPFCFFUUQRJKUVKECVKQPVQVJGQXGTCNNFGUKIPCGUVJGVKE+VKURGTHGEVCU an exterior or interior accent and its sleek look pairs well with modern materials such as block panels, glass and metal. The panel HGCVWTGUCFGNWZGƂPKUJVJCVTGƃGEVUNKIJVCPFETGCVGUVJGCRRGCTCPEGQHDTWUJGFRTGEKQWUOGVCNU6JGTKDDGFVGZVWTGCNNQYUVJG RCPGNVQCFFKPVGTGUVCPFXCTKCVKQP6JG4KDDGF2CPGNKUGCUKN[KPUVCNNGFYKVJQWTVKOGUCXKPIENKRKPUVCNNCVKQPU[UVGOCPFJKFFGP fasteners help maintain a clean design. #TG[QWTGCF[VQOCMGCDKIDQNFXKUWCNKORCEVD[WVKNK\KPIVJG&SWCNKVKGUQHVJG4KDDGF2CPGN!+VKUUWTGVQVCMGEGPVGTUVCIGCPF stand out from the crowd. Turn up the volume and drama on your next project. RIBBED™ MOTHER OF PEARL GUNSMOKE METALLIC SERIES RIBBED - NEW AWP 3030 DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 3,030MM [L]) THICKNESS (ACTUAL MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 57.3 WEIGHT (LBS. PER SQ. FT.) 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [29.62 SQ. FT.] Heavy metal is not just for the stage… it is also notorious for bringing walls to life NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY Unleash your inner rock star with thethe Rev it up! Add the Ribbed panel to your next focal wall.NOTE: THERE ARE 9 RIBS PER PANEL RIBBED | GUNSMOKE & MOTHER OF PEARL RIBBED | GUNSMOKE RIBBED | MOTHER OF PEARL RIBBED | MOTHER OF PEARL 6 7 DESIGNER SERIES Nichiha’s Illumination panels deliver sleek sophistication with ease Sleek, bold, vibrant. These are the words industry professionals are using to describe Nichiha’s Illumination ƂDGTEGOGPVRCPGN+VUUOQQVJUCVKPƂPKUJGCU[KPUVCNNCVKQPCPF virtually limitless color pallet give you a degree of design freedom that most cladding products simply can’t match. Delivering sleek sophistication comes naturally for Illumination. But don’t let the pretty face fool you; there’s more than meets the eye. Its ƂDGTEGOGPVEQPUVTWEVKQPKUDCEMGFD[0KEJKJCoU[GCTYCTTCPV[9JGPEQORCTGFVQ VTCFKVKQPCNCNWOKPWOEQORQUKVGCPFRJGPQNKERCPGNU+NNWOKPCVKQPFGNKXGTUUKIPKƂECPVN[ more bang for far fewer bucks. Illumination panels add a splash of color and style to a wide array of projects: Adding color and style to your projects has never been easier. Nichiha’s Color Xpressions System is a simple 3-step process for Illumination panels that opens up a nearly limitless world of possibilities. %QNQT:RTGUUKQPUKUDCEMGFD[C[GCTNKOKVGF HCEVQT[CRRNKGFƂPKUJYCTTCPV[ ILLUMINATION AWP 1818 AWP 3030 PROFILE LARGE WITHOUT SCORE SMALL WITH MIDPOINT VERTICAL SCORE DIMENSIONS (ACTUAL MM) 17-7/8” [H] X 71-9/16” [L] 17-7/8” [H] X 119-5/16” [L] (455MM [H] X 1,818MM [L]) (455MM [H] X 3,030MM [L] ) THICKNESS (ACTUAL MM) 5/8 (16MM) 5/8 (16MM) WEIGHT (LBS. PER PANEL) 35.2 57.2 WEIGHT (LBS. PER SQ. FT.) 3.9 3.8 EXPOSED COVERAGE (SQ. FT. PER PANEL) 8.88 SQ. FT. 14.81 SQ. FT. PACKAGING (PIECES PER PACK) 2 [17.76 SQ. FT.] 2 [29.62 SQ. FT.] www.nichiha.com5EJQQNU/WNVKHCOKN[/KZGF7UG1HƂEG$WKNFKPI*GCNVJECTG *See Nichiha warranties for detailed information on terms, conditions and limitations. NOTE: CAN BE INSTALLED HORIZONTALLY OR VERTICALLY. HAS A WIDER SOFT, U-SHAPED JOINT PROFILE IN COMPARISON TO THE AWP 1818 PROFILE. Some people see metal, others see masonry… all we see is stunning It’s not what you think, it’s Illumination ILLUMINATION | CUSTOM ILLUMINATION | CUSTOM ILLUMINATION | CUSTOM ILLUMINATION | CUSTOM City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 101 PLACE - ENVELOPE PROPOSALS ENDURAMAX Integrated Insulation with brick veneer high performance rain screen cladding system Complete integrated wall system approach Increased energy efficiency R13 Moisture management on two sides Sound reduction for acoustical comfort STC of 61db Can be paired with most Oldcastle masonry units including Trenwyth, Quik-Brik and select Artisan Veneers High end aesthetics available Unique design may cut installation time by up to 20% - up to 8 stories Wind Ratings Depending on building parameters, EnduraMax Wall System can withstand wind speeds of up to 140 MPH. Tested in accordance with ASTM E330. Fire resistance: EnduraMax Wall System may be used over any exterior fire resistance rated assembly without changing the assigned hourly rating allowing to meet a 2-hour fire rating. Tested in accordance with ASTM E119. EnduraMax is also NFPA 285 compliant. Code compliance 2015 International Building Code® (IBC) 2012 International Building Code® (IBC) EnduraMax Wall System qualifies for use in Type I, II, III or IV Construction The EnduraMax masonry veneer units shall have an average thickness of 1- 3 /4 to 2 inches (44.4 to 50.8 mm) depending upon product texture. Concrete masonry veneer units comply with ASTM C1634. Clay masonry veneer units comply with ASTM C1088. EPS Boards: Expanded polystyrene (EPS) boards are molded with pre-configured veneer patterns for insertion of match- ing veneer units. Figure 1 of this report shows typical veneer patterns. The EPS boards shall comply with ASTM C578 as Type I, with a minimum density of 0.9 pound per cubic foot (15 kg/m3 ). The EPS boards shall have a flame-spread index not greater than 25 and a smoke developed index not greater than 450 when tested in accordance with ASTM E84. EPS boards shall have a nominal thickness of 2 inches (51 mm) and include gaps and notches in the front molded veneer pattern as well as a vertically corrugated back face for water drainage. 25 year warranty ^ > d t>>dzW ^ ϭϬϬй ŶǀĞůŽƉĞсϮϰйǁŝŶĚŽǁƐнϳϲйtĂůů ϳϲйtĂůůсϱϳйtĂůůdLJƉĞηϮϮн ϭϵйtĂůůdLJƉĞηϮϯ ϮϮ Ϯϯ ŶǀĞůŽƉĞŝƐϭϮйŽĨƉƌŽũĞĐƚďƵĚŐĞƚ .43 &ROG&OLPDWH+LJK3HUIRUPDQFH$IIRUGDEOH+RXVLQJ 0F.QLJKW)RXQGDWLRQ3UHVHQWDWLRQ'HFHPEHU City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 102 PLACE - ENVELOPE PROPOSALS ENDURAMAX Astra-Glaze-SW+ Glazed Masonry Units Trendstone PlusTrendstone Cordova Stone Franklin Stone Harvard BrikBravissi Lamina Stone Mesastone Techture StoneQuik-Brik Traditional Verastone City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 103 PLACE - ENVELOPE PROPOSALS VERTICAL PV PANELS Vertically Integrated Photovoltaic panels The panels are installed a few inches from the exterior wall and rather than trans- fer heat onto the building itself, they actually allow air to circulate between the wall and the panel, creating a shading and insulating element. Modules Used: PS-A opaque, PS-C transparent Double Glazed Unit (DGU) Features of Polysolar’s Crystalline Silicon BIPV Module • Laminated for compliance with overhead and safety glass • Thermal properties similar to K glass. • High conversion rate of up to 15% • Rigorous quality of control standards and a worldwide certifica tion program • Product warranty 15 years • Power warranty 30 years Clear panels Features of Polysolar’s Micromorph Module • Advanced thin-film technology • High Power • Sleek and stylish aesthetics • Sustained performance in high ambient temperatures • Laminated for compliance with overhead and safety glass • Thermal properties similar to K glass. • High conversion rate of up to 8% • Rigorous quality of control standards and a worldwide certifica tion program • Product warranty 5 years • Power warranty 20 years City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 104 PLACE - ENVELOPE PROPOSALS Pella Impervia Fiberglass Windows Windows comply with 2012 and 2015 IBC Extruded fiberglass frame in multiple colors – no uv or color degradation Frame and glass expand and contract at same rate – long seal life 4 sided LowE coatings Integral insulation in frame – enhanced performance U value performance up to 0.23 - 24% better than Energy Star N requirements 12 year payback over baseline Triple pane glass is up to 0.17 but 3 times more money – takes up to 87 years pay- back 10 Year frame warranty 20 Year glass warranty City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 105 PLACE - ENVELOPE PROPOSALS EXTERIOR BALCONIES Endurable Balconies Prefabricated Exterior Balconies Endurable powder coated aluminum balconies Alumilast products are ultra low maintenance Fully engineered designed products Low thermal bridging - minimized to knife plates only Non combustible construction 50 year structural product warranty City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 106 PLACE - SUSTAINABILITY PROPOSALS EGENERATION = Solar PV + Wind + Anaerobic Digestion + Cogeneration + Greenhouse Anaerobic Digestion Energy Food waste from the residents, hotel and commercial will be con- verted into energy through the process of anaerobic digestion. A neighborhood-scaled anaerobic digestion system specifically designed by SEaB to be incorporated into communities will break down food waste using microbes whose methane output will be converted into energy. The byproducts of this process will be used as soil amend- ment and heat for the onsite greenhouse. This process will be en- tirely contained within the digester equipment and the E-Generation facility. Cogeneration Energy Optimizing the amount of energy generated onsite, the cogeneration process will convert methane from the grid into energy and heat. By combining cogeneration with solar, wind and anaerobic digestion re- newable energy sources, the residents and tenants will have access to affordable, reliable energy and hot water while decreasing the burden on the area’s electrical grid. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 107 The Beauty of Expediency. It’s a piece of art work. And yet it’s a func- tioning wind turbine producing electrical power. Some see DNA in its form. Some likens the movement of the turbine to the gracefulness of a ballerina pirouetting. Whatever the comparison is, all seem to be in accord that the whole unit is a beautiful addition to the building and the environment. Windside WS-4 has been developed for de- manding professional use as are the other Windside Wind Turbine family members. With this uncompromised quality, Windside is a safe and workable solution both in de- manding remote areas and in urban envi- ronment. Guaranteed Realiability. Quality Without Compromise. ® Environmental art work ”Wind Images” by artist Tarja Ervasti. Arabianranta, Helsinki, Finland. Photo by Ilkka Volanen. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 108 Windside® WS‑4—Beauty and efficiency OY WINDSIDE PRODUCTION LTD Keskitie 4 * FIN‑44500 Viitasaari, Finland * Tel. +358‑208‑350 700 * E‑mail: finland@windside.com* ® windside.com Like the other Windside models, WS‑4 has been built to last a lifetime. Only the highest grades of materials are used, and each individual will go through a careful finishing and inspection. Already the weight of the product is a proof of quality: ma‑ terials and durability have not been compromised. Besides safety, quality means also the ease of use. Windside turbines have been designed function as autonomous units with minimum need of service. Just install the turbine and leave it to work. The only maintenance needed is the lubrication of the bearings which can also be taken care of by an au‑ tomatic lubrication system. A 10 year limited warranty available. The WS‑4 model is available in all wind endurance classes (B– and A‑models). Please, check our web site www.windside.com and contact your nearest distributor. More information can be obtained also from the manufacturer: OY WINDSIDE PRODUCTION LTD Keskitie 4, FIN‑4400 Viitasaari Tel. +358‑208 350 700, fax +358‑208‑350 701 E‑mail: finland@windside.com You can easily run into a Windside WS‑4 wind turbine anywhere, since its usage purposes are innumerable. Wherever you need energy and there is no grid connection availabe, Windside WS‑4 will be at your service. They have been favoured in artistic installations and buildings, and at the same time they’ve been tested and used by Finnish Army as well as many other professional bodies. Windside WS‑4B / WS‑4A: ‑ Weight: 800 kg (B) / 1200 kg (A) ‑ Swept area: 4 m2 ‑ Generator: 50 A in delta, 28 A in star connection ‑ Voltage: 1‑200 V in delta, 1‑400 V in star connection ‑ WS‑4B and WS‑4A models max. 1000 rpm ‑ WS‑4B stands continuous winds of 40 m/s, and WS‑4A 60 m/s. Materials: ‑ Vanes: fibre glass ‑ Fastenings: aluminium ‑ Generator and end plates: steel and aluminium ‑ All bolts stainless steel or galvanized (A4, A2 or Zn) Assets of Windside wind turbines: ‑ No need to stop or secure during storms ‑ Produces max. amount of energy in storms ‑ Produces at low winds, below 3 m/s ‑ No need to be turned according to the wind direction ‑ Soundless (less than 5 dB, background noise always when measured) ‑ Stands snow, frost, heat, humidity and corrosion ‑ Allowed to be mounted on residential buildings ‑ Long lifespan ‑ Minimum need of maintenance, only lubrication City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 109 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 110 PLACE - SUSTAINABILITY PROPOSALS SOLAR CANOPY SKYLINE SOLAR OF AZ - PV PANEL SKYPORT - CANOPY STRUCTURE DUAL CANTILEVER 5,905 SF 9,260 SF MODEL ‘L-6-L’ PARTIAL CANTILEVER SkyPort Specifications Columns and Beams: (sized per site load conditions) Wide Flange Beam: ASTM A992 Gr. 50 Spacing: 18ft to 27ft O.C. Finish: One coat tinted water base rust inhibitive primer Optional: Hot Dip Galvanized ASTM A123 SkyPurlin Cold Formed #14ga. Steel ASTM A570 Gr. 55 Typical Size: 10” x 3-1/2” x 1-1/2” Finish: ASTM A653 G90 Galvanized Trim-Channel Cold Formed #14ga. Steel ASTM A570 Gr. 55 Typical Size: 10-1/8” x 2” Finish: ASTM A653 G90 Galvanized SkyBite Grounding Clamp: #14 ga. Stainless Steel 5/16” S/S Set screw, #12-14 Self Drilling Screw The project will maximize the amount of clean, solar energy generated within the development and photovoltaic panels will be located throughout the site. These panels will be visible and interwoven thoughtfully into the design to celebrate the communi- ty’s renewable energy capacity. On the roof, solar panels will coordinate with the green roof since research has shown these two systems perform even better together in a somewhat symbiotic relationship. A canopy of solar panels will cover the surface lot adjacent to the E-Generation facility, providing the additional benefits of keeping cars cool in the summer for less energy spent on air conditioning and keeping the lot clear of most snow in the winter to reduce emissions expelled while plowing. Solar panels will also be incorporated into the facade of the residential buildings, and placed to follow and absorb the maximum amount of sunlight. The Contractor shall verify and be responsible for all dimensions. DONOT scale the drawing - any errors or omissions shall be reported toStantec without delay.The Copyrights to all designs and drawings are the property ofStantec. Reproduction or use for any purpose other than thatauthorized by Stantec is forbidden. DescriptionNo.Date The Contractor shall verify and be responsible for all dimensions. DONOT scale the drawing - any errors or omissions shall be reported toStantec without delay.The Copyrights to all designs and drawings are the property ofStantec. Reproduction or use for any purpose other than thatauthorized by Stantec is forbidden. DescriptionNo.Date C102 SITE PLAN - NORTHWEST C104 SEE SH E E T C103SEE SHEET0 20 40 N DSA-PC Solar Carport-Single Cantilever ‘L’ – Shared Purlin - 5 or 6 Modules in Landscape Single cantilever column and beam structures with shared purlins are offered in two design models; L-5-L: Full Cantilever ‘L’, 5 module rows in Landscape @ 17’-0” max. beam length, 7 or 10 degree tilt angle L-6-L: Partial Cantilever ‘L’, 6 module rows in Landscape @ 20’-6” max. beam length, 7 or 10 degree tilt angle The ‘Shared Purlin’ design consists of (East/West) parallel purlins evenly spaced, below the length of the PV module in landscape. Adjacent PV module rows share the purlin and ‘middle clamps’, which are positioned along the ‘long side’ of the PV module frame. Design limits based on 5 or 6 PV modules 39” W x 65” L (approx.). Designs are choice of Tapered or Straight Beams, either Wide-Flange (W beam) or Hollow Structural Steel (HSS). The ‘W Beam’ attachment to the column is by stiffener plates welded to the HSS column and bolting the W Beam to the stiffener plates in the field. Option to Full-Pen. weld stiffener plates to the W beam and field weld to the HSS column. HSS beams are field welded to the HSS columns with a ’saddle’ stiffener plate between. Beams can be positive or negative tilt, positive shown below. Columns HSS Steel Tubing: ASTM A500, Grade B, Fy = 46 KSI Spacing: 20ft. or 27ft O.C. (see table) Finish: Hot Dip Galvanized ASTM A123 Beams W Beam: ASTM A992 or A572, Fy = 50 KSI HSS Beam: ASTM A500, Grade B, Fy = 46 KSI Finish: Hot Dip Galvanized ASTM A123 Cee Purlins Cold Formed #14GA. (or #12GA.) Steel ASTM A653, A1003 or A1011-04, Fy = 55 KSI Size: 10” x 3-1/2” Finish: ASTM A653 G90 Galvanized Trim Purlin End Caps: Cold Formed Steel #14GA. ASTM A653, A1003 or A1011-04, Fy = 55 KSI Size: 1000T125-43 Track Finish: ASTM A653 G90 Galvanized PV Module Mounting to Purlin SSI Top Clamps: W/2 Self Drilling Screws-#12 Option: SkyGrip Top Clamps-Self Grounding Beam Tilt Bay Spacing (Max) Wind Speed Snow Load Purlin Gauge 10-Degree 27'-0" 115 MPH 0 PSF # 12 10-Degree 27'-0" 110 MPH 0 PSF # 14 10-Degree 20'-0" 115 MPH 20 PSF # 14 7-Degree 27'-0" 115 MPH 0 PSF # 14 7-Degree 20'-0" 115 MPH 20 PSF # 14 Model ‘L-5-L’ Full Cantilever Model ‘L-6-L’ Partial Cantilever Shared Cee Purlin W or HSS Beam HSS Column 5 Module Rows in Landscape 631 W. Commerce Avenue - Gilbert, AZ. 85233 Tel: 480-926-0122 / Fax: 480-926-9178 www.skylinesolaraz.com / info@solarcarportsaz.com City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 111 PLACE - SUSTAINABILITY PROPOSALS SOLAR PANELS AT eGEN SKYLINE SOLAR OF AZ - PV PANEL Egen facility roof plan 3978 SF The project will maximize the amount of clean, solar energy generated within the development and photovoltaic panels will be located throughout the site. These panels will be visible and interwoven thoughtfully into the design to celebrate the communi- ty’s renewable energy capacity. On the roof, solar panels will coordinate with the green roof since research has shown these two systems perform even better together in a somewhat symbiotic relationship. 226 solar panels will cover the roof of the E-Generation facility. This is an addi- tional total of 3978 sf of capacity or Solar panels will also be incorporated into the facade and rooftops of the residential buildings, and placed to follow and absorb the maximum amount of sunlight. Flat plate system mounted to slope of roof following profile of roof City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 112 PLACE - SUSTAINABILITY PROPOSALS PV ROOF TEN K SOLAR - REFLECT PV SYSTEM Ten K Solar | 9231 Penn Avenue South, Minneapolis, MN 55431 | Toll free: 877-432-1010 | www.tenKsolar.com PRODUCT DATA SHEETPRODUCT DATA SHEETREFLECT™ PV SySTEm 70.87(1800)30.12(765)53.1 9(135 1 ) 45°26°29.15(740.30)77.87(1978)27.02(686.21)BackFrontSide 24.99(634.76)30.49(774.52)42.13(1070)84.38(2143.13) 28˚33˚ REFLECT 28 REFLECT 26 53.1 9(135 1 ) 77.87(1978) 77.87(1978) 77.87(1978) COMMERCIAL GROUND MOUNT STORAGE READY Mechanical SpecificationS Reflect 26 Reflect 28 Configuration Wave Module Tilt 26°28° Reflector Tilt 45°33° Module Compatibility Ten K Titan Series Inverter Compatability Ten K Redundant Inverter Bus Power Density 11.5 Wp /ft2 9.6 Wp /ft2 Base System Weight 2.8 lb/ft2 2.4 lb/ft2 Reflector Materials Tempered Glass, 3M™ Cool Mirror Film Racking Material Structural-grade aluminum alloys Roofpad Material Polymer Blend Wind Resistance‡Up to 120 mph Power Warranty‡‡25 Years Product Warranty‡‡25 Years Ten K Solar | 9231 Penn Avenue South, Minneapolis, MN 55431 | Toll free: 877-432-1010 | www.tenKsolar.com PRODUCT DATA SHEETPRODUCT DATA SHEETREFLECT™ PV SySTEm 70.87(1800)30.12(765)53.1 9(135 1 ) 45°26°29.15(740.30)77.87(1978)27.02(686.21)BackFrontSide 24.99(634.76)30.49(774.52)42.13(1070)84.38(2143.13) 28˚33˚ REFLECT 28 REFLECT 26 53.1 9(135 1 ) 77.87(1978) 77.87(1978) 77.87(1978) COMMERCIAL GROUND MOUNT STORAGE READY Mechanical SpecificationS Reflect 26 Reflect 28 Configuration Wave Module Tilt 26°28° Reflector Tilt 45°33° Module Compatibility Ten K Titan Series Inverter Compatability Ten K Redundant Inverter Bus Power Density 11.5 Wp /ft2 9.6 Wp /ft2 Base System Weight 2.8 lb/ft2 2.4 lb/ft2 Reflector Materials Tempered Glass, 3M™ Cool Mirror Film Racking Material Structural-grade aluminum alloys Roofpad Material Polymer Blend Wind Resistance‡Up to 120 mph Power Warranty‡‡25 Years Product Warranty‡‡25 Years TEN K SOLAR - REFLECT PV SYSTEM mounted on north building with green roof areas. TEN K SOLAR - REFLECT PV SYSTEM mounted on south buildings with green roof areas. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 113 PLACE - SUSTAINABILITY PROPOSALS PV VERTICAL SOLAR Polysolar Curtain Walling System Future Business Centre - Cambridge 2013 Objective:Generate renewable energy whilst utilising a weatherproof and artistic façade.Overall building requirement to achieve BREEAM Excellent. Solution:Building integrated PV curtain wall and bonded rainscreen façade Size:4.6 kW Module used:PS-A (100 watts) opaque, PS-C901 Transparent (90 Watts) double glazed (DGU) Project:The Future Business Centre (FBC) in Cambridge is a purpose built incubation centre for social and environmental enterprises, the first of its kind. Polysolar was requested to provide the PV glazing for the stairwell curtain wall and the decorative rainsceen cladding. Dortech were selected by prime contractors Interserve to supply the curtain wall system. Close liaison with Polysolar saw the first truly transparent curtain wall elements employed within the UK. Result:The installation uses Polysolar argon filled double-glazed PS-C series transparent units mounted in Reynaers curtain wall system. The PS-A-Series opaque units and the N-velope mounting frame provide an efficient bonded rainscreen façade. The cladding combines the benefits of a highlythermalefficientbuildingcladding material with renewable energy technology in one. It is designed to keep the cold out and the heat in during the winter and vice versa in summer. Polysolar's thin-film solar photovoltaic glass,whenfittedasadoubleglazedunit, offer U-values of 1.2 W/m 2K and G-values of 0.42. These figures are fundamental in driving the building into the highly coveted BREEAM category of Future Business Centre - Cambridge 2013 The sleek aesthetics and low cost of the Polysolar’s PV glazing makes it ideal for a wide variety of applications. This enables customers to showcase CSR and carbon commitments, meet planning and building regulations (BREEAM) and offer the customer an ability to differentiate their design while reducing their building operation costs. Reduction in energy consumption Aesthetic solution that also limits overheating and excessive sunlight Regulation of interior temperature, less need for A/C Reduction in CO2 emissions Environmental credentials For For For more information on Polysolar and its ground-breaking energy producing building materials please email info@polysolar.co.uk www.polysolar.com Tel: 01223 911534 PolysolarLimited,HauserForum,CharlesBabbageRd,Cambridge,CB30GT POLYSOLAR - CURTAIN WALLING SYSTEM • Reduction in energy consumption • Aesthetic solution that also limits overheating and excessive sunlight • Regulation of interior temperature, less need for A/C • Reduction in CO2 emissions • Environmental credentials The sleek aesthetics and low cost of the Polysolar’s PV glazing makes it ideal for a wide variety of applications. This enables cus- tomers to showcase CSR and carbon commitments, meet plan- ning and building regulations (BREEAM) and offer the customer an ability to differentiate their design while reducing their building operation costs. The panels are installed a few inches from the exterior wall and rather than transfer heat onto the building itself, they actually allow air to circulate between the wall and the panel, creating a shading and insulating element. Modules Used: PS-A opaque, PS-C transparent Double Glazed Unit (DGU) Features of Polysolar’s Crystalline Silicon BIPV Module • Laminated for compliance with overhead and safety glass • Thermal properties similar to K glass. • High conversion rate of up to 15% • Rigorous quality of control standards and a worldwide certification program • Product warranty 15 years • Power warranty 30 years City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 114 PLACE - SUSTAINABILITY PROPOSALS GREENROOF LIVEROOF - HYBRID GREEN ROOF SYSTEM City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 115 PLACE - SUSTAINABILITY PROPOSALS PV PANEL & GREENROOF SIZESPV systems for Place St. Louis Park 21‐Feb‐17 Location Type Vendor size number of units Watts per unit Total size Total Watts Notes North Building Array A rooftop tenksolar 38 sf 9 500 342 sf 4500 reflect Array B rooftop tenksolar 38 sf 24 500 912 sf 12000 reflect Array C rooftop tenksolar 38 sf 76 500 2888 sf 38000 reflect Array D rooftop tenksolar 38 sf 69 500 2622 sf 34500 reflect Array E rooftop tenksolar 38 sf 68 500 2584 sf 34000 reflect Array F rooftop tenksolar 38 sf 78 500 2964 sf 39000 reflect sub total 324 12312 sf 162000 Upper North Roof size 36230 sf Upper North Green roof 15907 sf Upper Mechanical areas 8011 sf Lower North roof 6368 sf Roof deck 735 sf Lower North green roof 972 sf Total north Green roof 16879 sf Total North roof 42598 sf North Elevations BIPV array A 15.4 sf 198 220 3059 sf 43560 BIPV array B 15.4 sf 70 220 1078 sf 15400 BIPV array C 15.4 sf 40 220 620 sf 8800 Subtotal 15.4 sf 308 220 4757 sf 67760 North Canopy Car canopy Solarcity AZ 17.6 sf 863 270 15198 sf 233010 Egen building Solarcity AZ 17.6 sf 226 270 3978 sf 61020 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 116 PLACE - SUSTAINABILITY PROPOSALS PV PANEL & GREENROOF SIZES South Hotel Building Array G rooftop tenksolar 38 sf 47 500 1786 sf 23500 reflect Green Roof 5381 sf 7167 sf Hotel Mechanical areas 3085 sf Total Hotel roof 10252 sf Hotel BIPV Elevation 15.4 sf 198 220 3059 sf 43560 South Residential Building Array H rooftop tenksolar 38 sf 59 500 2242 sf 29500 reflect Array I rooftop tenksolar 38 sf 56 500 2128 sf 28000 reflect Green Roof 9291 sf 13661 sf Hotel Mechanical areas 3661 sf Total Hotel roof 17322 sf Residential BIPV Elevation 15.4 sf 198 220 1152 sf 43560 Total Project Green roof 31551 sf Total Egen solar Solarcity AZ 17.6 sf 226 270 3978 sf 61020 Total Rooftop solar tenksolar 38 sf 486 500 18468 sf 243000 reflect system Total Car Canopy solar SolarCityAZ 17.6 sf 863 270 15198 sf 233010 includes structure Total BIPV polysolar 15.4 sf 704 220 8968 sf 154880 colored system Total Solar capacity 46612 sf 691910 Total Roof area 70172 sf City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 117 PLACE - SUSTAINABILITY PROPOSALS 4 A502 4 A502 5 A502 5 A502 A210 1 A210 2 A210 3 A2104 A2114 UP UP MECH SOUND PROOF ROOM 1 250 SF SOUND PROOF ROOM 2 500 SF EXCERCISE 400 SF REC BASEMENT FLOOR GROSS 8,120 SF STORAGE 5,438 SF -13 -5.67 7 5 12 12 7 18 BICYCLE PARKING AT EACH STALL MOUNTED TO WALL TOTAL COUNT = 62 in lower level of parking BICYCLE STORAGE ROOM 1500 sf STEADY RACK SYSTEM = capacity for 140 in storage 1-3 Features and Advantages 4 The Steadyrack Advantage 5-6 Spacing Guide 7 Mounting Heights 8 Care and Maintenance Contents SOUTH INTERIOR BICYCLE PARKING PROPOSAL City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 118 PLACE - SUSTAINABILITY PROPOSALS NORTH INTERIORBICYCLE PARKING PROPOSAL EXERCISE 894 SF SOUND PROOF ROOM 606 SF STORAGE 6639 SF BIKE STORAGE 2650 SF 15 10 23 29 14 8 MECH 486 SF 1 A502 1 A502 A106 1 A106 2 A106 4 A106 6 A106 3 A106 5 VAN ELEC CAR CHARGING STATION (TYP) 1 2 3 4 5 6 7 BICYCLE PARKING AT EACH STALL MOUNTED TO WALL TOTAL COUNT = 94 BICYCLE STORAGE ROOM 2650 sf STEADY RACK SYSTEM = capacity for 247 1-3 Features and Advantages4 The Steadyrack Advantage 5-6 Spacing Guide 7 Mounting Heights 8 Care and Maintenance ContentsCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 119 TECHNICAL MEMORANDUM 72 -DFN6XOOLYDQ3( &LW\RI6W/RXLV3DUN )520 *UDKDP-RKQVRQ3( +HDWKHU.LHQLW]3( '$7( -XQH 5( 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ 6(+1R67/28 7KLVWHFKQLFDOPHPRUDQGXPSURYLGHVILQGLQJVUHODWHGWRDWUDIILFLPSDFWDQDO\VLVSHUIRUPHGWRHYDOXDWHD SRWHQWLDOGHYHORSPHQWLQ6W/RXLV3DUNORFDWHGHDVWRI:RRGGDOH$YHQXH7KHGHYHORSPHQWZRXOG RFFXURQWZRVHSDUDWHSDUFHOV 7KHQRUWKHUQVLWHLVORFDWHGHDVWRI:RRGGDOH$YHQXHDQGVRXWKRIWKHHDVWERXQG7+HQWUDQFHUDPS ORFDWHGDORQJWKHHDVWOHJRIWKHIURQWDJHURDG7KLVVLWHZDVSUHYLRXVO\WKH6NLSS\0F*DUYH\SDUFHODQG LVFXUUHQWO\RZQHGE\WKH&LW\RI6W/RXLV3DUN(FRQRPLF'HYHORSPHQW$XWKRULW\ ('$ 7KHVRXWKHUQVLWHLVORFDWHGLQWKHQRUWKHDVWFRUQHURIWKHLQWHUVHFWLRQRI:RRGGDOH$YHQXHDQGWK 6WUHHW WKLVVLWHLVFXUUHQWO\RFFXSLHGE\1DVK)UDPH'HVLJQ7KLVVLWHLVFXUUHQWO\GLYLGHGDQGRZQHGE\ WZRSDUWLHVWKH+HQQHSLQ&RXQW\5HJLRQDO5DLOURDG$XWKRULW\ +&55$ DQGWKH&LW\RI6W/RXLV3DUN )LJXUHRQWKHIROORZLQJSDJHUHSUHVHQWVWKHLPPHGLDWHSURMHFWDUHDDQGKLJKOLJKWVWKHUHGHYHORSPHQW DUHDORFDWLRQVDVZHOODVWKHVWXG\LQWHUVHFWLRQV7KHILQGLQJVRIWKLVDQDO\VLVZLOOLGHQWLI\WKHWUDIILF LPSDFWVWKDWWKHGHYHORSPHQWZLOOKDYHDWWKHIROORZLQJLQWHUVHFWLRQV •:RRGGDOH$YHQXH :%7+5DPS7HUPLQDO •:RRGGDOH$YHQXH (%7+5DPS7HUPLQDO •:RRGGDOH$YHQXH )URQWDJH5RDG •:RRGGDOH$YHQXH WK6WUHHW •WK6WUHHWDW;HQZRRG$YHQXH 7KHLQWHUVHFWLRQDWWK6WUHHWDQG<RVHPLWH$YHQXH6RXWKZDVQRWHYDOXDWHGWRUHSUHVHQWWKHZRUVWFDVH VFHQDULRZLWKWKHQHZWULSVIURPWKHVRXWKHUQVLWHFRQFHQWUDWHGDWWKHVLJQDOL]HG;HQZRRG$YHQXH LQWHUVHFWLRQ$SSHQGL[)LJXUHVKRZVDGUDIWVLWHSODQIRUWKHVRXWKHUQVLWHRIWKHSURSRVHG3/$&( GHYHORSPHQW (QJLQHHUV_$UFKLWHFWV_3ODQQHUV_6FLHQWLVWV Short Elliott Hendrickson Inc., 5HG&LUFOH'ULYH6XLWH0LQQHWRQND01 6(+LVHPSOR\HHRZQHG_sehinc.com_ __ ID[ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 120 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Figure 1 Project Location EXISTING CONDITIONS ([LVWLQJWXUQLQJPRYHPHQWFRXQWVDWWKHILYHVWXG\LQWHUVHFWLRQVZHUHXWLOL]HGIURPDVWXG\ SUHYLRXVO\FRPSOHWHGIRUWKH&LW\RI6W/RXLV3DUN6LQFHWKLVSHULRGWKHUHKDVEHHQRQJRLQJ FRQVWUXFWLRQZRUNRQ7+LQWKHDUHDLQFOXGLQJUHSODFHPHQWRIWKH0LQQHWRQND%RXOHYDUG &6$+ %ULGJHRYHU7+7KHVWXG\ZDVLQLWLDWHGGXULQJWKLVSHULRGWKXVQHZWUDIILFFRXQWVZHUHQRWREWDLQHG &XUUHQWO\ERWK7+UDPSWHUPLQDOLQWHUVHFWLRQVDQGWKHIURQWDJHURDGLQWHUVHFWLRQRSHUDWHXQGHUPLQRU VWUHHWVWRSFRQWURO7KH&HGDU/DNH7UDLOFURVVHV:RRGGDOH$YHQXHDWJUDGHRQWKHVRXWKVLGHRIWKH IURQWDJHURDGLQWHUVHFWLRQ7KHUHLVDQH[LVWLQJDWJUDGHIUHLJKWUDLOFURVVLQJEHWZHHQWKHIURQWDJHURDG DQGWK6WUHHW ,QWKH&LW\FRPSOHWHGWZRORFDOSURMHFWVLQWKHLPPHGLDWHSURMHFWDUHDDORQJWK6WUHHW *HRPHWULFDQGVLJQDOUHYLVLRQVZHUHPDGHDWWKH:RRGGDOH$YHQXHDQGWK6WUHHWLQWHUVHFWLRQ LQFOXGLQJQHZVHSDUDWHGQRUWKERXQGDQGHDVWERXQGOHIWWXUQODQHVDQGWKHLQVWDOODWLRQRI)ODVKLQJ <HOORZ$UURZ )<$ SURWHFWHGSHUPLVVLYHOHIWWXUQVLJQDOSKDVHVRQDOODSSURDFKHV $WUDIILFVLJQDOZDVLQVWDOOHGDWWKHWK6WUHHWDQG;HQZRRG$YHQXHLQWHUVHFWLRQ7KHQRUWKERXQGDQG VRXWKERXQG;HQZRRG$YHQXHDSSURDFKHVKDYHVKDUHGOHIWWKURXJKDQGVHSDUDWHULJKWWXUQODQHV :HVWERXQGWK6WUHHWKDVDVKDUHGWKURXJKULJKWWKURXJKODQHDQGVHSDUDWHOHIWWXUQODQHZLWKD )<$SURWHFWHGSHUPLVVLYHOHIWWXUQVLJQDOSKDVH(DVWERXQGWK6WUHHWKDVDVKDUHGWKURXJKULJKW DQGVKDUHGOHIWWKURXJKODQHZLWKSHUPLVVLYHSKDVLQJ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 121 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH )LJXUHVKRZVWKHWUDIILFDQDO\VLVQHWZRUNZLWKH[LVWLQJ$0DQG30SHDNKRXUYROXPHV City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 122 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Figure 2 Existing Traffic DemandsCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 123 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH PLANNED IMPROVEMENTS 7KHUHDUHFXUUHQWO\WZRPDMRUSURMHFWVWKDWZLOOKDYHDQLPSDFWRQWUDYHOGHPDQGLQWKHUHJLRQ2QHLV FXUUHQWO\XQGHUFRQVWUXFWLRQDQGWKHHQYLURQPHQWDOGRFXPHQWIRUWKHRWKHUKDVMXVWEHHQSXEOLVKHG MnDOT TH 100 7KHILUVWLPSURYHPHQWLVDODUJHVFDOHUHFRQVWUXFWLRQSURMHFWWKDWLVFXUUHQWO\XQGHUZD\DORQJ7+ 0Q'27EHJDQFRQVWUXFWLRQLQIDOORIDQGLWLVSODQQHGIRUFRPSOHWLRQE\ODWHIDOORI7KH SXUSRVHRIWKHSURMHFWLVWRDGGUHVVEDVLFLQIUDVWUXFWXUHGHILFLHQFLHVLPSURYHLQWHUFKDQJHVDIHW\DW7+ DQG0LQQHWRQND%RXOHYDUGDQGWRLPSURYHWKHWUDIILFRSHUDWLRQVRI+LJKZD\WKURXJKZLGHQLQJRI7+ WRLQFOXGHWKUHHODQHVLQHDFKGLUHFWLRQDQGLPSURYHPHQWVWRUDPSDFFHOHUDWLRQPHUJLQJVSDFLQJ LQFOXGLQJDX[LOLDU\ODQHVEHWZHHQWKHUDPSFRQQHFWLRQV7KHSURMHFWDOVRLQFOXGHV • 5HFRQVWUXFWLRQRIWKHEULGJHDQGUDPSVDWWKH0LQQHWRQND%RXOHYDUG &6$+ LQWHUFKDQJHWR SURYLGHDIXOOGLDPRQGLQWHUFKDQJHFRQILJXUDWLRQ7KLVUHSODFHVWKHSUHYLRXVFRQILJXUDWLRQRIWKH RIIVHWLQWHUVHFWLRQDW9HUQRQ$YHQXHIRUWKHVRXWKERXQGH[LWUDPSDQGWKHIROGHGGLDPRQGIRU QRUWKERXQGWUDIILF • 5HFRQVWUXFWLRQRIWKHEULGJHDQGUDPSVDWWKH7+LQWHUFKDQJHLQFOXGLQJDIROGHGGLDPRQGIRU ERWKGLUHFWLRQVRI7+KRZHYHUVRXWKERXQG7+ZLOOLQFOXGHGLUHFWLRQDOH[LWUDPSVWKDW ZLOOQRWWUDYHOWKURXJKWKHZHVWUDPSWHUPLQDOLQWHUVHFWLRQ7KLVUHSODFHVWKHSUHYLRXVGHVLJQRID IROGHGGLDPRQGIRUVRXWKERXQGWUDIILFDQGDVWDQGDUGGLDPRQGIRUQRUWKERXQGWUDIILF • 5HFRQVWUXFWLRQRIWKHIUHLJKWUDLOEULGJHRYHU7+ • 5HFRQVWUXFWLRQRIWKHSHGHVWULDQWUDLOEULGJHRYHU7+ Southwest Light Rail Transit Project 7KH6RXWKZHVW/LJKW5DLO7UDQVLW 6:/57 3URMHFWLVWKHSURSRVHGH[WHQVLRQRIWKH0(752*UHHQ/LQH /57WRFRQQHFWWRWKHVRXWKZHVWPHWURDUHD,WZLOOH[WHQGDSSUR[LPDWHO\PLOHVIURP(GHQ3UDLULH LQWRGRZQWRZQ0LQQHDSROLV2QHRIWKHSODQQHGVWDWLRQVDORQJWKHLQWHQGHGURXWHZLOOEHORFDWHGDW :RRGGDOH$YHQXH 7KH&LW\RI6W/RXLV3DUNKDVDJUHHGWRWKH6:/573URMHFW2IILFH 632 SURSRVHGLPSURYHPHQWVWRWKH :RRGGDOH$YHQXHDUHDWRVHUYHWKHH[LVWLQJDQGIXWXUHWUDIILFGHPDQGVLQWKHLPPHGLDWHYLFLQLW\RIWKH QHZ/57VWDWLRQ7KHFXUUHQWSODQLVIRUWKH/57WRFURVV:RRGGDOH$YHQXHDWJUDGHZLWKDSSUR[LPDWHO\ PLQXWHKHDGZD\VLQHDFKGLUHFWLRQ $VSDUWRIWKHDQDO\VLVFRQGXFWHGE\632WKHIROORZLQJLPSURYHPHQWVZHUHLGHQWLILHGIRULQFOXVLRQLQWKH 6:/57SURMHFWVFRSH •7UDIILFVLJQDOVDWWKH7+UDPSWHUPLQDOLQWHUVHFWLRQVRQ:RRGGDOH$YHQXH •5HVWULSH:RRGGDOH$YHQXHWRDODQHVHFWLRQ •5HVWULFWWKHIXOODFFHVV)URQWDJH5RDGLQWHUVHFWLRQWRULJKWLQULJKWRXW 5,52 DFFHVV − 7KH&LW\KDVUHFHQWO\UHTXHVWHGWKDWWKLVDFFHVVEHPRGLILHGWRLQFOXGHDVRXWKERXQGOHIWWXUQ ODQHRQWRWKHHDVWOHJRIWKH)URQWDJH5RDGWKLVLVFXUUHQWO\XQGHUFRQVLGHUDWLRQE\632 • 1HZVLJQDOV\VWHPDQGJDWHVIRUWKHIUHLJKWDQG/57FURVVLQJV • 1HZJUDGHVHSDUDWHGWUDLOFURVVLQJIRUWKH&HGDU/DNH/577UDLODW:RRGGDOH$YHQXH XQGHUSDVV 7KH6:/57LPSURYHPHQWVOLVWHGDERYHDUHFRQVLGHUHGSDUWRIWKH³EDVH´IXWXUHFRQGLWLRQDQGLQFOXGHGLQ DOOIXWXUHPRGHOVXVHGWRHYDOXDWHWKH3/$&(GHYHORSPHQWSURSRVDO City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 124 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH BASE TRAFFIC FORECASTS – BACKGROUND GROWTH $VSDUWRIWKH6:/573URMHFWWUDIILFIRUHFDVWVZHUHGHYHORSHGIRUWKH:RRGGDOH$YHQXHFRUULGRU 7KH632SURMHFWWHDPUHYLHZHGDKLVWRULFDOOLQHDUUHJUHVVLRQDQDO\VLVDQGWKH7ZLQ&LWLHV5HJLRQDO 7UDYHO'HPDQG0RGHO 7&57'0 DQGWKHQFRPSDUHGWKHUHVXOWV XOWLPDWHO\XVLQJJURZWKIDFWRUVWR FRQYHUWWKHWXUQLQJPRYHPHQWVWRWXUQLQJPRYHPHQWV %DVHGRQDUHYLHZRIWKHVRFLRHFRQRPLFGDWDLQSXWVLQWKHIRUHFDVWPRGHOXVHGE\632FHQVXV GDWDDQGWKH&LW\¶VODWHVWODQGXVHSODQWKHJURZWKIDFWRUVWKDW632DSSOLHGWRWKHLQWHUVHFWLRQWXUQLQJ PRYHPHQWVIURPH[LVWLQJWRZHUHGHWHUPLQHGWREHZLWKLQUHDVRQDEOHUDQJHVE\6(+VWDII7KLV UHIOHFWVEDFNJURXQGJURZWKGXULQJWKH30SHDNKRXUZLWKRXWWKH3/$&(GHYHORSPHQWRIDSSUR[LPDWHO\ SHU\HDURQ:RRGGDOH$YHQXHDWWKHUDLOFURVVLQJ LQFUHDVHEHWZHHQDQG ZLWK FHUWDLQWXUQLQJPRYHPHQWVDFURVVWKHVWXG\DUHDLQFUHDVLQJDWGLIIHUHQWUDWHVWKDQRWKHUV 2040 Base Forecast )LJXUHVKRZVWKHWUDIILFDQDO\VLVQHWZRUNZLWK%DVH)RUHFDVW$0DQG30SHDNKRXUYROXPHV ZLWKRXWWKH3/$&(GHYHORSPHQW5DWKHUWKDQUHIHUULQJWRWKLVIRUHFDVWDVWKH1R%XLOG FRQGLWLRQDVLVW\SLFDOLQVXFKDQDO\VLVLWLVUHIHUUHGWRDVWKH³%DVH)RUHFDVW´WRDYRLGFRQIXVLRQ ZLWKWKHEXLOGVWDWXVRIWKH6:/57DQGUHODWHGLPSURYHPHQWV,QVXPPDU\WKH%DVH)RUHFDVW LQFOXGHV • $VVXPSWLRQRIWKHEDVH6:/57,PSURYHPHQWV • %DFNJURXQG*URZWKWR±ZLWKRXWWKH3/$&(GHYHORSPHQW 7\SLFDOO\DWUDIILFLPSDFWVWXG\LVQRWLQWHQGHGWRIRUHFDVWRXWWRDGHVLJQ\HDUIRUHFDVWRI\HDUVLQWRWKH IXWXUH+RZHYHUWKHIRUHFDVWLQJZRUNZDVXVHGWRLGHQWLI\QHFHVVDU\DUHDLPSURYHPHQWVIRU LPSOHPHQWDWLRQZLWKWKH6:/57DQGWKHZRUNSURYLGHVDQXQGHUVWDQGLQJRIWKHIXWXUHSHUIRUPDQFHRIWKH WUDIILFDQDO\VLVQHWZRUNXQGHUIXWXUHGHPDQGYROXPHVZLWKWKHSURSRVHGLPSURYHPHQWV )RUWKH3/$&(WUDIILFLPSDFWDQDO\VLVWKHIRUHFDVWVFHQDULRZDVXVHGWRHVWLPDWHWKHDPRXQWRI WUDIILFWKDWPD\EHVHUYHGDWWKH)URQWDJH5RDGLQWHUVHFWLRQGXHWRWKHFORVHO\VSDFHGLQWHUVHFWLRQVDQG UDLOFURVVLQJVDORQJ:RRGGDOH$YHQXH7KHDQDO\VLVFRQGXFWHGIRUWKHIRUHFDVW\HDUDOVRSURYLGHV DQLQGLFDWLRQRIZKHUHLVVXHVPD\DULVHXQGHUWKHIRUHFDVWWUDIILFJHQHUDWLRQDQGIXWXUHJHRPHWULFV 2020 Base Forecast 7KHDQDO\VLV\HDURIZDVLGHQWLILHGIRUXVHLQWKHWUDIILFLPSDFWDQDO\VLVWRFRLQFLGHZLWKDWLPHIUDPH QHDUWKHSODQQHGRSHQLQJRIERWKWKH6:/57DQGWKH3/$&(GHYHORSPHQW7KHIRUHFDVWWUDIILF GHPDQGVZHUHGHYHORSHGXVLQJDVWUDLJKWOLQHJURZWKEHWZHHQWKHDQGGHPDQGV7KLVUHIOHFWV EDFNJURXQGJURZWKGXULQJWKH30SHDNKRXUZLWKRXWWKH3/$&(GHYHORSPHQWRIDSSUR[LPDWHO\SHU \HDURQ:RRGGDOH$YHQXHDWWKHUDLOFURVVLQJ LQFUHDVHEHWZHHQDQG ZLWKFHUWDLQWXUQLQJ PRYHPHQWVDFURVVWKHVWXG\DUHDLQFUHDVLQJDWGLIIHUHQWUDWHVWKDQRWKHUV7KHFRUUHVSRQGLQJJURZWK IDFWRUVZHUHDSSOLHGWRWKHH[LVWLQJWXUQLQJPRYHPHQWV7KHUHVXOWDQWIRUHFDVWVDUHDVVXPHGWREH WKH³EDVH´WUDIILFGHPDQGVDQGLQFOXGHEDFNJURXQGJURZWKLQWKHSURMHFWDUHDZLWKRXWWKH3/$&( GHYHORSPHQW)LJXUHVKRZVWKHWUDIILFDQDO\VLVQHWZRUNZLWK%DVH)RUHFDVW$0DQG30SHDNKRXU YROXPHVZLWKRXWWKHDGGLWLRQDO3/$&(GHYHORSPHQWYROXPHV ,QVXPPDU\WKH%DVH)RUHFDVWLQFOXGHV • $VVXPSWLRQRIWKHEDVH6:/57,PSURYHPHQWV •%DFNJURXQG*URZWKWR±ZLWKRXWWKH3/$&(GHYHORSPHQW City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 125 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Figure 3 2040 Base Forecast AM and PM peak hour (without PLACE)City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 126 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Figure 4 2020 Base Forecast AM and PM peak hour (without PLACE) City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 127 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH PROPOSED PLACE DEVELOPMENT - TRIP GENERATION & DISTRIBUTION 7KHKLJKOLJKWHGDUHDVLQ)LJXUHDUHWKHSURSRVHGUHGHYHORSPHQWVLWHORFDWLRQVIRUWKH3/$&( GHYHORSPHQW:KLOHWKHFXUUHQW3/$&(GHYHORSPHQWSODQLVVSOLWEHWZHHQWKHWZRVLWHVWKHIROORZLQJLVD VXPPDU\RIWKHWRWDOGHYHORSPHQWSODQIURPERWKORFDWLRQV •QHZDSDUWPHQWXQLWV •URRP+RWHO • VTXDUHIHHWRIFRPPHUFLDOUHWDLOVSDFH • (*HQHUDWLRQVLWH 7ULSJHQHUDWLRQHVWLPDWHVZHUHGHYHORSHGXVLQJWKH,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHU¶V7ULS *HQHUDWLRQ0DQXDO WK(GLWLRQ6RPHRIWKHSURSRVHGFRPPHUFLDOUHWDLOVSDFHZLWKLQWKHGHYHORSPHQW ZRXOGIDOOLQWRWKH³6SHFLDOW\5HWDLO&HQWHU´FDWHJRU\ZLWKLQWKHWULSJHQHUDWLRQPDQXDOKRZHYHUWKHUHLV OLPLWHGVDPSOHGDWDZLWKLQWKHPDQXDOWKXVDEOHQGRIGLIIHUHQWUHWDLOJHQHUDWLRQUDWHVZDVGHYHORSHGE\ FRQVXOWDQWZRUNLQJZLWKWKH3/$&(GHYHORSPHQWWHDPDQGSURYLGHGWR6(+IRUWKLVDQDO\VLV$UHYLHZRI WKHEOHQGHGUDWHIRXQGLWWREHUHDVRQDEOH,WVKRXOGEHQRWHGWKDWWKHFRIIHHKRXVHDQGUHVWDXUDQWDUH SODQQHGIRUORFDWLRQZLWKLQWKHKRWHOSURSHUW\QRWDVVWDQGDORQHEXVLQHVVHVZLWKVWUHHWIURQWDJH:KLOH SODQQHGDVSDUWRIWKHKRWHOWKHWZREXVLQHVVHVDUHHVWLPDWHGVHSDUDWHO\EHORZPDLQWDLQLQJFRQVLVWHQF\ ZLWKWKHDSSURDFKRIWKHGHYHORSHU¶VFRQVXOWDQW 7DEOHVXPPDUL]HVWKHWULSJHQHUDWLRQHVWLPDWHVIRUGDLO\$0SHDNKRXUDQG30SHDNKRXUGHPDQGVIRU WKHQRUWKDQGVRXWKVLWHVDVZHOODVWKHFRPELQHGWRWDOV WKHDWWDFKHG$SSHQGL[7DEOHVKRZVWKH FRPSOHWHWULSJHQHUDWLRQDVVXPSWLRQV Table 1 – PLACE Development Trip Generation ITE Code/Land Use Development Trip Daily AM Peak PM Peak Num. Units Reduction Total Enter Exit Total Enter Exit Total NORTHERN DEVELOPMENT SITE $SDUWPHQW 8QLWV &RPPHUFLDO5HWDLO 6TIW (*HQHUDWLRQ6LWH HPS 1RUWK6LWH7RWDOV SOUTHERN DEVELOPMENT SITE $SDUWPHQW 8QLWV +RWHO 5RRP 5HVWDXUDQW&DIH 6TIW &RIIHHKRXVH 6TIW &RPPHUFLDO5HWDLO 6TIW 6RXWK6LWH7RWDOV PLACE Development Totals 3,365 128 152 280 174 128 302 7ULSUHGXFWLRQVZHUHWDNHQEDVHGRQODQGXVHW\SHDQGIDFLOLWLHVLQWKHDUHDIRUWKHIROORZLQJ •7UDQVLW •%LF\FOH:DON •3DVVE\ • ,QWHUQDO&DSWXUH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 128 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH $FKLHYHPHQWRIWKHVHWULSUHGXFWLRQVZLOOUHTXLUHWKHVLWHWRHPSOR\WUDYHOGHPDQGPDQDJHPHQWVWUDWHJLHV VXFKDVVHFXUHELF\FOHSDUNLQJDQGWUDQVLWLQFHQWLYHV7KHVXSSO\RISDUNLQJZLOOLPSDFWWKHDPRXQWRI WULSVJHQHUDWHGE\DGHYHORSPHQWDQGVKRXOGEHUHYLHZHGWRHQVXUHWKDWLWVXSSRUWVWKHDXWRWULS UHGXFWLRQDVVXPSWLRQVPDGHIRUWKLVDQDO\VLV 1HZWULSVZHUHGLVWULEXWHGEDVHGRQH[LVWLQJWUDIILFSDWWHUQVSUHYLRXVWUDIILFVWXGLHVDQGEDVHGRQWKH GLVWULEXWLRQLQIRUPDWLRQIURPWKH7&57'0)LJXUHLOOXVWUDWHVWKHUHVXOWDQWGLVWULEXWLRQWRDQGIURPWKH SURSRVHGVLWHVDQGWKHJHQHUDOORFDWLRQVDQGGLVWULEXWLRQVDUHDOVRGHVFULEHGEHORZ •:HVWRQ7+ •(DVWRQ7+ •1RUWKRQ:RRGGDOH$YHQXH •6RXWKRQ7+ •1RUWKRQ7+ • (DVWRQ WK6WUHHW $VVKRZQE\)LJXUHWKHYDVWPDMRULW\RIWULSVDUHGLVWULEXWHGWRUHJLRQDOV\VWHPZLWKRQO\WRWKH QRUWKRQ:RRGGDOH$YHQXHDQGWRWKHHDVWRQWK6WUHHW 7KHQRUWKVLWHZLOOKDYHOLPLWHGDFFHVVEDVHGRQWKHIURQWDJHURDGLQWHUVHFWLRQZLWK:RRGGDOH$YHQXH FRQYHUWLQJWRDUHVWULFWHGDFFHVVLQWHUVHFWLRQDVSDUWRIWKH6:/57SURMHFW7KHUHIRUHDOOWUDIILFH[LWLQJ WKHQRUWKVLWHPXVWWXUQULJKWDQGZDVGLVWULEXWHGWRWKHQRUWKZLWKGLUHFWDFFHVVWR7+DQG:RRGGDOH $YHQXH HDVWRQ7+DOVRSURYLGHVDFFHVVWR7+(QWHULQJWUDIILFPD\DFFHVVWKHVLWHIURPERWK GLUHFWLRQVRQ:RRGGDOH$YHQXH 7KHVRXWKVLWHZDVDQDO\]HGXQGHUWZRVHSDUDWHDFFHVVFRQGLWLRQV Right-in/Right-out 7KHILUVWFRQGLWLRQRQO\SURYLGHVDFFHVVWRWKHVLWHYLDWKHH[LVWLQJGULYHZD\DFFHVVORFDWHGRQWK6WUHHW 'XHWRWKHSUR[LPLW\RIWKHDFFHVVWRWKH:RRGGDOH$YHQXHLQWHUVHFWLRQDSSUR[LPDWHO\IHHWWKH DFFHVVZRXOGRSHUDWHXQGHU5,52FRQWURO7UDIILFURXWLQJZRXOGEHYHU\LQFRQYHQLHQWIRUDOOYHKLFOHV WUDYHOLQJWRDQGIURPWKHVLWH(QWHULQJWUDIILFZRXOGKDYHWRHQWHUWKHVLWHWUDYHOLQJZHVWERXQGDORQJWK 6WUHHW'XHWROLPLWHGFRQQHFWLRQVWRZHVWERXQGWK6WUHHWWUDIILFZRXOGHLWKHUURXWHRQORQJHUWUDYHO SDWKVRUZRXOGWUDYHODORQJHDVWERXQGWK6WUHHWDQGLQLWLDWHD8WXUQPRYHPHQWWRKHDGZHVWERXQG 7UDIILFH[LWLQJWKHVLWHZLOOGRVRLQWRDIUHTXHQWO\TXHXHGULJKWWXUQODQHDORQJWK6WUHHW7KHKHDY\ ZHVWERXQGWK6WUHHWWRQRUWKERXQG:RRGGDOH$YHQXHPRYHPHQWFXUUHQWO\TXHXHVWKURXJKWKLVDFFHVV RQDUHJXODUEDVLVDQGYHKLFOHVGHVWLQHGWRWKHVRXWKVLWHZRXOGLQFXUORQJHUGHOD\WLPHVDVDUHVXOW $OVRGXHWRWKHSUR[LPLW\RIWKHDFFHVVWRWKH:RRGGDOH$YHQXHVLJQDOH[LWLQJWUDIILFZRXOGKDYHWR H[HFXWHDGLIILFXOWPDQHXYHUWRHQWHUWKHOHIWWXUQODQHDQGWUDYHOVRXWKERXQGRQ:RRGGDOH$YHQXHLQ RUGHUWRDFFHVVVRXWKERXQG7+ 35th Street Connection 7KHVHFRQGRSWLRQIRUDFFHVVWRWKHVRXWKVLWHSURYLGHVDFRQQHFWLRQWRWK6WUHHWZKLFKZRXOGSURYLGH DFFHVVWRERWK<RVHPLWH$YHQXHDQG;HQZRRG$YHQXH7KHFRQQHFWLRQWR;HQZRRG$YHQXHZRXOG SURYLGHVLWHWUDIILFZLWKDIXOOVLJQDOFRQWUROOHGDFFHVVDWWKHLQWHUVHFWLRQRI;HQZRRG$YHQXHDQGWK 6WUHHWIRUWUDIILFWRHQWHUDQGH[LWWKHVLWHLQDQ\GLUHFWLRQ7KHLQWHUVHFWLRQDWWK6WUHHWDQG<RVHPLWH $YHQXH6RXWKZDVQRWLQFOXGHGLQWKHPRGHOLQJWRUHSUHVHQWWKHZRUVWFDVHVFHQDULRZLWKWKHQHZWULSV IURPWKHVRXWKHUQVLWHFRQFHQWUDWHGDWWKHVLJQDOL]HG;HQZRRG$YHQXHLQWHUVHFWLRQ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 129 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Figure 5 PLACE Trip DistributionCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 130 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH PREVIOUS PLACE DEVELOPMENT ANALYSIS 7KH3/$&(GHYHORSPHQWZDVSUHYLRXVO\DQDO\]HGXQGHUGLIIHUHQWDVVXPSWLRQV7KHLQLWLDOGHYHORSPHQW DQDO\VLVLQFOXGHGDSSUR[LPDWHO\WKHVDPHVL]HRIGHYHORSPHQWKRZHYHULWZDVDOOORFDWHGRQWKHQRUWK VLWH'XHWRWKHOLPLWHGDFFHVVDWWKH)URQWDJH5RDGLQWHUVHFWLRQRIULJKWLQULJKWRXWRQO\DQGWKHFORVHO\ VSDFHGLQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXHWKHWRWDOVL]HRIWKHGHYHORSPHQWH[FHHGHGWKHFDSDFLW\RI WKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH$YHQXHDQGFUHDWHGH[FHVVLYHGHOD\VIRUERWKWKH GHYHORSPHQWWUDIILFDQGDOOWUDIILFDORQJ:RRGGDOH$YHQXHDQGWK6WUHHW U-turn Analysis 7KHEDVH632SURMHFWSODQRIUHVWULFWHGULJKWLQULJKWRXWDFFHVVDWWKH:RRGGDOH$YHQXHLQWHUVHFWLRQ ZLWKWKH)URQWDJH5RDGUHVXOWHGLQWKHLQDELOLW\IRUVRXWKERXQGDQGZHVWERXQGPRWRULVWVWRWXUQOHIWIRU GHYHORSPHQWDFFHVVWKXVUHTXLULQJD8WXUQPRYHPHQWDWDGRZQVWUHDPLQWHUVHFWLRQRUUHURXWLQJ:KLOH LWLVOLNHO\VRPHUHVLGHQWVHPSOR\HHVDQGIUHTXHQWSDWURQVZRXOGSODQWKHLUURXWHWRDYRLGWKHQHHGIRU8 WXUQVKRWHOJXHVWVDQGRWKHUVZLOODWWHPSW8WXUQV,QLWLDOWUDIILFPRGHOLQJVKRZHGWKDWDODUJHQXPEHURI 8WXUQVDWWKHWZRGRZQVWUHDPLQWHUVHFWLRQVZRXOGSUHVHQWVLJQLILFDQWRSHUDWLRQDOFKDOOHQJHVIRUPDQ\ PRYHPHQWVEHWZHHQWKH:RRGGDOH$YHQXHLQWHUVHFWLRQVDWWKH1RUWK7+5DPSDQGWK6WUHHW,WZDV DOVRGHWHUPLQHGWKDWWKH8WXUQDW:RRGGDOH$YHQXHDQGWK6WUHHWZRXOGQRWEHIHDVLEOHIRUD SDVVHQJHUFDUQRUVLQJOHXQLWWUXFNZLWKRXWWUDFNLQJRQWRWKHVLGHZDONRUEH\RQGEDVHGRQJHRPHWULF WXUQLQJWHPSODWHDQDO\VHVFRQGXFWHG)XUWKHUGHVSLWHWKHJHRPHWULFFRQIOLFWWKHVRXWKERXQGOHIWWXUQ VLJQDOSKDVH WKHSRWHQWLDO8WXUQPRYHPHQWSKDVH KDVDFRQFXUUHQWULJKWWXUQRYHUODSSKDVHIRUWKH KHDY\ZHVWERXQGULJKWWXUQWUDIILF7KLVFRXOGQRWEHGRQHZLWKWKHSUHVHQFHRI8WXUQVGXHWRWKHFRQIOLFW EHWZHHQ8WXUQVDQGULJKWWXUQVHQWHULQJWKHVDPHODQHV+RZHYHUQRWDOORZLQJDQRYHUODSSKDVHZRXOG VLJQLILFDQWO\GHWHULRUDWHWKHLQWHUVHFWLRQFDSDFLW\7KXVLWZDVUHFRPPHQGHGWKDW8WXUQVEHSURKLELWHGDW WKH:RRGGDOH$YHQXHDQGWK6WUHHWLQWHUVHFWLRQZLWKVLJQLQJDQGHQIRUFHPHQWDVQHHGHG U-turn Mitigation 7RUHGXFHWKH8WXUQUHODWHGFRQJHVWLRQLQWKHWUDIILFPRGHODQGPLWLJDWHWKHWUDIILFVLJQDOSKDVLQJDQG JHRPHWULFFRQIOLFWVLQWURGXFHGE\D8WXUQDWWKH:RRGGDOH$YHQXHDQGWK6WUHHWLQWHUVHFWLRQD VRXWKERXQGOHIWWXUQODQHZDVDGGHGDWWKH)URQWDJH5RDGLQWHUVHFWLRQ7KHORFDWLRQRIWKLVODQHQRUWKRI WKHUDLOWUDFNVSUHVHQWVQRFRQIOLFWZLWKUDLODQGWKHPRGHOLQJVKRZHGWKDWWKHODQHLPSURYHGFDSDFLW\ DORQJWKH:RRGGDOH$YHQXHFRUULGRUZLWKDOLPLWHGQXPEHURIQHZGHYHORSPHQWWULSVKRZHYHUWKH LQLWLDOO\SURSRVHGGHYHORSPHQWRQWKHQRUWKVLWHVWLOOH[FHHGHGFDSDFLW\0RGHOLWHUDWLRQVZHUHFRQGXFWHG WRLGHQWLI\WKHOHYHORIWUDIILFJHQHUDWLRQWKDWWKHSODQQHGDGMDFHQWVWUHHWQHWZRUNFRXOGVHUYHDWWKHQRUWK VLWHZLWKWKHDGGLWLRQRIWKHVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDG7KHQXPEHURIQHZWULSV LGHQWLILHGZDVDSSUR[LPDWHO\DWWKHQRUWKVLWH 7KHDGGLWLRQDOWUDIILFJHQHUDWLRQDVVRFLDWHGZLWKWKHFXUUHQWO\SURSRVHGGHYHORSPHQWSODQIRUWKHQRUWK VLWHLVZLWKLQWKHWKUHVKROGLGHQWLILHGIRUPDLQWDLQLQJDFFHSWDEOHRSHUDWLRQVDWWKHVWXG\LQWHUVHFWLRQV OPERATIONS ANALYSIS AND ALTERNATIVES :LWKSODQQHGLPSURYHPHQWVRFFXUULQJDVSDUWRIWKH6:/57EDVHSURMHFWLQWKHEDVHVFHQDULRZLWK QRGHYHORSPHQWZLOOLQFOXGHWKHIROORZLQJFKDQJHVIURPWKHH[LVWLQJFRQGLWLRQV •7UDIILFVLJQDOVDWWKH7+UDPSWHUPLQDOLQWHUVHFWLRQVRQ:RRGGDOH$YHQXH •5HVWULSHG:RRGGDOH$YHQXHWRDODQHVHFWLRQ •5HVWULFWWKHIXOODFFHVV)URQWDJH5RDGLQWHUVHFWLRQWRULJKWLQULJKWRXWDFFHVVZLWKDVRXWKERXQGOHIW WXUQODQH − 7KH&LW\KDVUHFHQWO\UHTXHVWHGWKDWWKH632SURMHFWLQFOXGHWKLVVRXWKERXQGOHIWWXUQODQHDQGLW LVXQGHUFRQVLGHUDWLRQ • *UDGHVHSDUDWHGWUDLOFURVVLQJIRUWKH&HGDU/DNH/577UDLODW:RRGGDOH$YHQXH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 131 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH 7KRXJKQRWGLUHFWO\WLHGWRWKHGHYHORSPHQWDQDO\VLVDIRUHFDVWVFHQDULRZDVDOVRLQFOXGHGWROHDUQ WKHSRWHQWLDOIXWXUHWUDIILFLPSDFWVRIWKHSURSRVHGVLWHDQGRWKHUSODQQHGGHYHORSPHQWLQWKHDUHD7KUHH VHSDUDWHVFHQDULRVZHUHDQDO\]HGIRUERWKDQG7KHIROORZLQJLVDGHVFULSWLRQRIHDFK •6FHQDULR$ %DVH)RUHFDVW − 6:/57EDVHLPSURYHPHQWVQR3/$&(GHYHORSPHQWWUDIILF •6FHQDULR% %DVH)RUHFDVW − 6:/57EDVHLPSURYHPHQWVQR3/$&(GHYHORSPHQWWUDIILF •6FHQDULR$ %DVH3/$&('HYHORSPHQW7UDIILF − 6:/57EDVHLPSURYHPHQWV − 1RUWKDQG6RXWKVLWH3/$&(GHYHORSPHQWWUDIILF − 6RXWKVLWHRQO\KDVGLUHFW5,52DFFHVVIURPWK6WUHHW •6FHQDULR% %DVH3/$&('HYHORSPHQW7UDIILF − 6:/57EDVHLPSURYHPHQWV − 1RUWKDQG6RXWKVLWH3/$&(GHYHORSPHQWWUDIILF − 6RXWKVLWHRQO\KDVGLUHFW5,52DFFHVVIURPWK6WUHHW •6FHQDULR$ %DVH3/$&('HYHORSPHQW7UDIILFZLWKWK6WUHHWFRQQHFWLRQ − 6:/57EDVHLPSURYHPHQWV − 1RUWKDQG6RXWKVLWHGHYHORSPHQWWUDIILF − 6RXWKVLWHKDVGLUHFW5,52DFFHVVIURP WK6WUHHWDQGDQHZFRQQHFWLRQWRWK6WUHHWSURYLGLQJ WKHVLWHDFFHVVWR;HQZRRG$YHQXH •6FHQDULR% %DVH3/$&('HYHORSPHQW7UDIILFZLWKWK6WUHHWFRQQHFWLRQ − 6:/57EDVHLPSURYHPHQWV − 1RUWKDQG6RXWKVLWHGHYHORSPHQWWUDIILF − 6RXWKVLWHKDVGLUHFW5,52DFFHVVIURP WK6WUHHWDQGDQHZFRQQHFWLRQWRWK6WUHHWSURYLGLQJ WKHVLWHDFFHVVWR;HQZRRG$YHQXH Traffic Operations Model and Level of Service $VSDUWRIWKH6:5/73URMHFWDWUDIILFRSHUDWLRQVPRGHOZDVGHYHORSHGXVLQJWKH9,66,0VRIWZDUH SDFNDJH7KLVVRIWZDUHDOORZVIRUUHDOLVWLFWUDIILFRSHUDWLRQVDVZHOODVDOORWKHUPRGHVRIWUDQVSRUWDWLRQ LQFOXGLQJSHGHVWULDQVEXVHV LQFOXGLQJEXVVWRSV DQGWKH/57WUDIILFZLWKJDWHFORVXUHV$VSDUWRID VHSDUDWHVWXG\6(+XSGDWHGWKH6329,66,0PRGHOWRUHILQHVRPHDVSHFWVRIWKHPRGHODVZHOODV H[SDQGWKHQXPEHURILQWHUVHFWLRQVLQFOXGHG ,QWHUVHFWLRQ/HYHORI6HUYLFHDVGHILQHGLQWKH+LJKZD\&DSDFLW\0DQXDOLVDTXDOLWDWLYH SHUIRUPDQFHPHDVXUHWKDWUHSUHVHQWVTXDOLW\RIVHUYLFHLQGLFDWLQJKRZZHOODQLQWHUVHFWLRQLVRSHUDWLQJ ,QWHUVHFWLRQVDUHUDQNHGIURP/26$WKURXJK/26)7KH/26UHVXOWVDUHEDVHGRQDYHUDJHGHOD\SHU YHKLFOHZKLFKFRUUHVSRQGWRWKHGHOD\WKUHVKROGYDOXHVVKRZQLQ7DEOH/26$LQGLFDWHVWKHEHVWWUDIILF RSHUDWLRQDQG/26)LQGLFDWHVDQLQWHUVHFWLRQZKHUHGHPDQGH[FHHGVFDSDFLW\2YHUDOOLQWHUVHFWLRQ/26 $WKURXJK'LVFRQVLGHUHGWREHDFFHSWDEOHWUDIILFIORZFRQGLWLRQVLQWKH7ZLQ&LWLHV0HWURSROLWDQDUHD City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 132 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 2: Level of Service Criteria for Signalized and Unsignalized Intersections LOS Designation Signalized Intersection Average Delay/Vehicle (seconds) Unsignalized Intersection Average Delay/Vehicle (seconds) $ %!±!± &!±!± '!±!± (!±!± )!! 7KH&LW\RI6W/RXLV3DUNSUDFWLFHVXJJHVWVWKDWLQWHUVHFWLRQVRSHUDWHDW/26'RUEHWWHUWRIDFLOLWDWHVDIH DQGHIILFLHQWPRYHPHQWDFURVVWKHWUDQVSRUWDWLRQQHWZRUN 'XULQJWKHSUHYLRXVZRUNFRQGXFWHGE\6(+WKURXJKERWKWKH6323URMHFWDQGWKH6(+WUDIILFPRGHO XSGDWHWKH$0SHDNKRXUDQDO\VLVVKRZHGQRFRQJHVWLRQUHODWHGLVVXHVWKURXJKWKHGHVLJQ\HDU 7KHWULSJHQHUDWLRQHVWLPDWHVIRUWKLVGHYHORSPHQWDUHYHU\FRPSDUDEOHEHWZHHQWKH$0DQG30SHDN KRXU$VVXFKRQO\WKH303HDNKRXUWUDIILFGHPDQGVZHUHDQDO\]HGDVSDUWRIWKLVLPSDFWVWXG\ 7KHRSHUDWLRQVDQDO\VLVIRUDOOPRGHOHGDOWHUQDWLYHVLVVXPPDUL]HGLQ$SSHQGL[7DEOH 2020 ALTERNATIVES 7KHDQDO\VLV\HDURIZDVLGHQWLILHGIRUXVHLQWKHWUDIILFLPSDFWDQDO\VLVWRFRLQFLGHZLWKDWLPHIUDPH QHDUWKHSODQQHGRSHQLQJRIERWKWKH6:/57DQGWKHSRWHQWLDO3/$&(GHYHORSPHQW SCENARIO 1A – 2020 BASE FORECAST 7KHWUDIILFGHPDQGVZLWKRXW3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXH :LWKWKHURDGZD\LPSURYHPHQWVDQGWKH6:/57RSHUDWLQJWKHRYHUDOOLQWHUVHFWLRQRSHUDWLRQVDUHDW/26 %RUEHWWHU7KHUHLVVRPHTXHXHLQJEHWZHHQLQWHUVHFWLRQVGXHWRWKHFORVHVSDFLQJRIWKHIRXU LQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH+RZHYHUPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDUHDFKVLJQDOZLWKLQ RQHF\FOH7KHZHVWERXQG7+OHIWWXUQLVWKHH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFN WKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQWKHUDPS 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ DWWDFKHG$SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 133 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 3: Scenario 1A – 2020 Base Forecast PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK ,QWHUVHFWLRQ :RRGGDOH$YHQXH# :%7+5DPS 1% $$$ % 6% %$% :%82.46 /F $ $' :RRGGDOH$YHQXH# (%7+5DPS 1% $ $ $ % 6%% $$ (% '$& & :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ $ 6%& $$$ (%&& :% $ $ :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% $ $6% $ $ :RRGGDOH$YHQXH# WK6WUHHW 1% ' ' $ % % 6%%%$% (%&'$' :%&'$& WK6WUHHW# ;HQZRRG$YHQXH 1% & & $ & $ 6%& %$& (%$$$$ :% %$$$ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 134 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH SCENARIO 2A – 2020 BASE + PLACE DEVELOPMENT TRAFFIC 7KHWUDIILFGHPDQGVZLWK3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXHDQGRQO\5,52DFFHVVIURPWK6WUHHWWRWKHVRXWKVLWH 7KHLQFUHDVHGGHYHORSPHQWWULSVKDYHDPLQLPDOLPSDFWRQWKHURDGZD\QHWZRUNWKHRYHUDOOLQWHUVHFWLRQ RSHUDWLRQVDUHUHPDLQDW/26%RUEHWWHU7KHUHLVVRPHTXHXHLQJEHWZHHQLQWHUVHFWLRQVGXHWRWKHFORVH VSDFLQJRIWKHIRXULQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH+RZHYHUPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDU HDFKVLJQDOZLWKLQRQHF\FOH7KHH[LWLQJZHVWERXQG7+OHIWWXUQLVWKHH[FHSWLRQZLWKGRZQVWUHDP TXHXLQJLVVXHVWKDWFDQEORFNWKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQ WKHUDPS :LWKRQO\WKHVLQJOHH[LWLQJDFFHVVIURPWKHVRXWKHUQGHYHORSPHQWDOOWUDIILFH[LWLQJWKLVVLWHZRXOG RSHUDWHDWD/26)DVWUDIILFDWWHPSWVWRHQWHUWKHZHVWERXQGWK6WUHHWTXHXH$SSUR[LPDWHO\RI WKHH[LWLQJGHYHORSPHQWWUDIILFZDVXQDEOHWRHQWHUWKHURDGZD\QHWZRUNZLWKLQWKHPRGHOZKLFKUHVXOWVLQ EHWWHURSHUDWLRQVDWVRPHLQWHUVHFWLRQVWKDQZRXOGRFFXULIDOOWUDIILFZHUHDEOHWRHQWHUWKHPRGHO )XUWKHUWKHWUDIILFHQWHULQJWKHVRXWKHUQ3/$&(GHYHORSPHQWZRXOGIDFHVLJQLILFDQWURXWLQJFKDOOHQJHV ZLWKRQO\WKH5,52DFFHVVDWWK6WUHHW$FFHVVLQJWKHVLWHIURPWKHZHVWUHTXLUHVWKDWPRWRULVWVPXVW FLUFXODWHIDUWKHUDORQJWKHVWUHHWQHWZRUNWRDUULYHIURPWKHHDVWRUPDNHD8WXUQPRYHPHQWDWWKHWK 6WUHHWLQWHUVHFWLRQVRI<RVHPLWH$YHQXHRU;HQZRRG$YHQXH 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ DWWDFKHG$SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 135 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 4: Scenario 2A – 2020 Base + PLACE Development Traffic, PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK ,QWHUVHFWLRQ :RRGGDOH$YHQXH# :%7+5DPS 1% $$$ % 6%&$ % :%80.03 /F $ $' :RRGGDOH$YHQXH# (%7+5DPS 1% $ $ $ % 6% % $$ (%'$ && :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ $ 6%'$$$ (%&& :%%% :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% $ $ 6% $ $ :RRGGDOH$YHQXH# WK6WUHHW 1% ' ' $ % % 6%%%$% (%' '% ' :%& &%% WK6WUHHW# ;HQZRRG$YHQXH 1% & & $ & $ 6%&'$& (%%$$$ :%%$$$ WK6WUHHW# 3ODFH$FFHVV :% & & 6%76.32 /F 76.3 /F City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 136 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH SCENARIO 3A – 2020 BASE + PLACE DEVELOPMENT TRAFFIC WITH 35TH STREET CONNECTION 7KHWUDIILFGHPDQGVZLWK3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXHDQGDFFHVVWRWKHVRXWKVLWHSURYLGHGE\ERWKD5,52DFFHVVRQWK6WUHHWDQGDFRQQHFWLRQWR WK6WUHHW7KHWK6WUHHWFRQQHFWLRQDOORZVWUDIILFWRDFFHVVWK6WUHHWIURPWKH<RVHPLWH$YHQXHRU WKH;HQZRRG$YHQXHWUDIILFVLJQDO)RUWKHSXUSRVHVRIWKLVDQDO\VLVWKHVRXWKVLWHWUDIILFZDVURXWHGRQO\ WR;HQZRRG$YHQXHYLDWKHWK6WUHHWFRQQHFWLRQZLWKDVPDOOQXPEHURIWULSVPDLQWDLQHGDWWKH SURSRVHGGULYHZD\ 7KHLQFUHDVHGGHYHORSPHQWWULSVKDYHDPLQLPDOLPSDFWRQWKHURDGZD\QHWZRUNWKHRYHUDOOLQWHUVHFWLRQ RSHUDWLRQVUHPDLQDW/26%RUEHWWHU7KHUHLVVRPHTXHXHLQJEHWZHHQLQWHUVHFWLRQVGXHWRWKHFORVH VSDFLQJRIWKHIRXULQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH+RZHYHUPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDU HDFKVLJQDOZLWKLQRQHF\FOH7KHH[LWLQJZHVWERXQG7+OHIWWXUQLVWKHH[FHSWLRQZLWKGRZQVWUHDP TXHXLQJLVVXHVWKDWFDQEORFNWKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQ WKHUDPS 7KHHDVWERXQG;HQZRRG$YHQXHDSSURDFKZDVPRGHOHGZLWKWZRODQHVDVKDUHGWKURXJKOHIWWXUQODQH DQGDVKDUHGWKURXJKULJKWWXUQODQH WKHH[LVWLQJFRQGLWLRQ 7KHOHIWWXUQGHPDQGLVUHODWLYHO\ORZ DSSUR[LPDWHO\YHKLFOHVZKLOHWKHGHYHORSPHQWWULSJHQHUDWLRQZRXOGLQFUHDVHWKLVGHPDQGWR DSSUR[LPDWHO\YHKLFOHV:KLOHWKHRYHUDOOPRYHPHQWRSHUDWHGDWD/26&DOOYHKLFOHVPDNLQJWKLV OHIWZRXOGEORFNRQHRIWKHWZRWKURXJKODQHVDQGLQFUHDVHWKHSRWHQWLDOIRUUHDUHQGFROOLVLRQV7KHUHIRUH LWLVUHFRPPHQGHGWKDWWKHLQFUHDVHGGHPDQGVIRUWKHHDVWERXQGOHIWWXUQEHVHSDUDWHGIURPWKHWKURXJK ODQHVZLWKDOHIWWXUQODQHDSSUR[LPDWHO\IHHWLQOHQJWK :LWKWZRRSWLRQVWRH[LWWKHVRXWKGHYHORSPHQWVLWHPRUHWUDIILFH[LWLQJWKLVVLWHFDQDFFHVVWKHURDGZD\ QHWZRUNIURP;HQZRRG$YHQXHWKDQWKH5,52GULYHZD\DFFHVV7KLVDOOHYLDWHVWKHGHPDQGDWWKH5,52 DFFHVV:KLOHWKHVRXWKERXQG5,52ZRXOGVWLOORSHUDWHDWD/26(WKHWRWDOGHPDQGGLVWULEXWHGWRWKLV H[LWZDVUHODWLYHO\ORZ YHKLFOHV$SSHQGL[7DEOH DQGWUDIILFPD\ILQGDQHTXLOLEULXPE\FKRRVLQJWR H[LWDWWKH5,52<RVHPLWH$YHQXHRUWKH;HQZRRG$YHQXHVLJQDOGHSHQGHQWXSRQWUDIILFFRQGLWLRQV 7KHPRGHOLQJRIWKH3/$&(GHYHORSPHQWRQWKHVRXWKVLWHVXJJHVWVWKDWWKHH[LVWLQJODQHFRQILJXUDWLRQ IRUWKHVRXWKERXQGDQGQRUWKERXQG;HQZRRG$YHQXHDSSURDFKHVRSHUDWHVDFFHSWDEO\DQGWKXVWKH H[LVWLQJULJKWWXUQODQHDQGVKDUHGWKURXJKOHIWWXUQODQHVKRXOGEHPDLQWDLQHG$SSHQGL[7DEOHVKRZV WKHOHQJWKRIDYHUDJHDQGPD[LPXPTXHXHVIRUWKHVRXWKERXQGDSSURDFKHVWKHPD[LPXPTXHXHVDUH DVIROORZV •6KDUHGWKURXJKOHIWWXUQODQH±IHHW •5LJKWWXUQODQH±IHHW $IXWXUHWUDIILFVWXG\RISRWHQWLDOUHGHYHORSPHQWDQGRUVWUHHWFRQQHFWLRQDOWHUQDWLYHVVRXWKRIWK6WUHHW ZRXOGEHQHFHVVDU\WRLGHQWLI\WKHQHHGWRSURYLGHGHGLFDWHGOHIWWXUQODQHVIRUWKHQRUWKERXQGDQG VRXWKERXQGDSSURDFKHVDQGWKHUHTXLUHGVWRUDJHRIWKRVHODQHVDVZHOODVWKHULJKWWXUQODQHV7KHQHHG IRUDGHGLFDWHGOHIWWXUQODQHZRXOGLPSDFWWKHDPRXQWRIRQVWUHHWSDUNLQJSURYLGHGDORQJ;HQZRRG $YHQXHZKLFKLVDSSUR[LPDWHO\IHHWZLGH 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ $SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 137 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 5: Scenario 3A – 2020 Base + PLACE Development Traffic with 35 th Street connection, PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK 'HOD\/26 ,QWHUVHFWLRQ 'HOD\/26 :RRGGDOH$YHQXH# :%7+5DPS 1% $ $ $ % 6%&$& :%92.24 /F $ $( :RRGGDOH$YHQXH# (%7+5DPS 1% $ $ $ % 6% %$$ (% '$'' :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ $ 6%'$$ $ (% && :% %% :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% $ $ 6% $ $ :RRGGDOH$YHQXH# WK6WUHHW 1% ' ( $ % % 6%%%$% (%''% ' :% & &%% WK6WUHHW# ;HQZRRG$YHQXH 1% & & $ & % 6%&& $& (%&$$$ :%%%%% WK6WUHHW# 3ODFH$FFHVV :% & & 6%43.25 /E 43.3 /E City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 138 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH 2040 ALTERNATIVES 7KHFORVHO\VSDFHGLQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXHLQFOXGLQJWKHSODQQHG/57DQGH[LVWLQJIUHLJKW UDLOFURVVLQJVUHGXFHWKHDPRXQWRIDYDLODEOHVWRUDJHDORQJWKHFRUULGRUOLPLWLQJWKHQXPEHURIYHKLFOHV WKDWPD\EHVHUYHGHDFKWUDIILFVLJQDOF\FOH$VVXFKWKHIRUHFDVWVFHQDULRZDVXVHGLQSUHYLRXV ZRUNWRXQGHUVWDQGWKHSRWHQWLDOWUDIILFJHQHUDWLRQIRUWKHQRUWKVLWHZKLFKGLUHFWO\DFFHVVHV:RRGGDOH $YHQXH7KLVVFHQDULRKDVEHHQFDUULHGIRUZDUGIRUWKLVDQDO\VLVWROHDUQWKHSRWHQWLDOIXWXUHWUDIILF LPSDFWVRIWKHSURSRVHGVLWHDQGRWKHUSODQQHGGHYHORSPHQWDQGLPSURYHPHQWVLQWKHDUHD SCENARIO 1B – 2040 BASE FORECAST 7KHWUDIILFGHPDQGVZLWKRXW3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXH :LWKWKHURDGZD\LPSURYHPHQWVDQGWKH6:/57RSHUDWLQJWKHRYHUDOOLQWHUVHFWLRQRSHUDWLRQVDUHDWD /26&RUEHWWHU±WKLVLVLPSURYHGRYHUWKHSUHYLRXVEDVHILQGLQJVZLWKWKHLQFOXVLRQRIWKHVRXWKERXQG /7DWWKHIURQWDJHDQGWKHUHVXOWLQJUHGXFWLRQLQ8WXUQV7KHPRGHOVKRZVWKHUHLVVRPHTXHXHLQJ EHWZHHQLQWHUVHFWLRQVGXHWRWKHFORVHVSDFLQJRIWKHIRXULQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH :KLOHPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDUHDFKVLJQDOZLWKLQRQHF\FOHERWK7+RIIUDPSVDUH H[FHSWLRQV7KHZHVWERXQG7+OHIWWXUQLVWKHH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFN WKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQWKHUDPS7KHHDVWERXQG7+ H[LWUDPSLVDQRWKHUH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFNWKHULJKWWXUQPRYHPHQW RQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHFDQVSLOORXWWR7+DORQJWKHUDPS :LWKWKHLQFUHDVHLQEDFNJURXQGWUDIILFDORQJ:RRGGDOH$YHQXHWKHHDVWERXQGDQGZHVWERXQG7+H[LW UDPSVH[SHULHQFHH[FHVVLYHGHOD\V /26) DVWKHOLPLWHGVWRUDJHDORQJ:RRGGDOH$YHQXHLVTXLFNO\ ILOOHGGXULQJWKHUDLOHYHQWV'XULQJWKHHYHQWVWKHVLJQDOFRRUGLQDWLRQLVLQWHUUXSWHGDQGLWPD\WDNH VHYHUDOF\FOHVIRUWKHVLJQDOSKDVLQJFKDQJHVFDWFKXSVXFKWKDWWKHUDPSWUDIILFPD\QRWDGYDQFHRQ JUHHQ 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ DWWDFKHG$SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 139 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 6: Scenario 1B – 2040 Base Forecast PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK 'HOD\/26 ,QWHUVHFWLRQ 'HOD\/26 :RRGGDOH$YHQXH# :%7+5DPS 1% $$ $ % 6%&$& :%97.83 /F $% ' :RRGGDOH$YHQXH# (%7+5DPS 1% $ $ $ & 6%%$$ (%90.07 /F $94.86 /F 94 /F :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ $ 6% '$$ $ (%37.89 /E 37.9 /E :%%% :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% $ $ 6% % % :RRGGDOH$YHQXH# WK6WUHHW 1% '57.92 /E $ & & 6% %%$% (%'' % ' :%''$' WK6WUHHW# ;HQZRRG$YHQXH 1% & $ $ & $ 6%&%$& (%$ $ $ $ :%% $$$ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 140 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH SCENARIO 2A – 2040 BASE + PLACE DEVELOPMENT TRAFFIC 7KHWUDIILFGHPDQGVZLWK3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXHDQGRQO\5,52DFFHVVIURPWK6WUHHWWRWKHVRXWKVLWH 7KHLQFUHDVHGGHYHORSPHQWWULSVKDYHDPLQLPDOLPSDFWRQWKHURDGZD\QHWZRUNWKHRYHUDOOLQWHUVHFWLRQ RSHUDWLRQVDUHVWLOODWD/26&RUEHWWHU7KHUHLVVRPHTXHXHLQJEHWZHHQLQWHUVHFWLRQVGXHWRWKHFORVH VSDFLQJRIWKHIRXULQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH :KLOHPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDUHDFKVLJQDOZLWKLQRQHF\FOHERWK7+RIIUDPSVDUH H[FHSWLRQV7KHZHVWERXQG7+OHIWWXUQLVWKHH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFN WKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQWKHUDPS7KHHDVWERXQG7+ H[LWUDPSLVDQRWKHUH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFNWKHULJKWWXUQPRYHPHQW RQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHFDQVSLOORXWWR7+DORQJWKHUDPS :LWKRQO\WKHVLQJOHH[LWLQJDFFHVVIURPWKHVRXWKHUQGHYHORSPHQWDOOWUDIILFH[LWLQJWKLVVLWHZRXOG RSHUDWHDWD/26)DVWKH\DWWHPSWWRHQWHUZHVWERXQGWK6WUHHWTXHXH$SSUR[LPDWHO\RIWKH H[LWLQJGHYHORSPHQWWUDIILFZHUHXQDEOHWRHQWHUWKHURDGZD\QHWZRUN7KLVLVDELJIDFWRUIRUZK\WKHUH ZDVRQO\PLQLPDOLPSDFWWRWKHQHWZRUNDVWKHIXOOWUDIILFGHPDQGVZHUHQRWEHLQJVHUYHG 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ $SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 141 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 7: Scenario 2B – 2040 Base + PLACE Development Traffic PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK ,QWHUVHFWLRQ :RRGGDOH$YHQXH# :%7+5DPS 1% $$ $ % 6% &$& :%91.61 /F $ %' :RRGGDOH$YHQXH# (%7+5DPS 1% $ $ $ & 6% &$$ (%83.46 /F $95.46 /F 93.2 /F :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ $ 6%'$$$ (%'' :% % % :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% $ $ 6% % % :RRGGDOH$YHQXH# WK6WUHHW 1% '65.03 /E $ & & 6% %% $% (%''%' :%& &%& WK6WUHHW# ;HQZRRG$YHQXH 1% & & $ & & 6%&&%& (% &$$ $ :%' ''' WK6WUHHW# 3ODFH$FFHVV :%38.49 /E 38.5 /E 6%231.56 /F 231.6 /F City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 142 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH SCENARIO 3B – 2040 BASE + PLACE DEVELOPMENT TRAFFIC WITH 35TH STREET CONNECTION 7KHWUDIILFGHPDQGVZLWK3/$&(GHYHORSPHQWWUDIILFZHUHHYDOXDWHGZLWKWKHEDVH6:/57 LPSURYHPHQWVLQFOXGLQJDVRXWKERXQGOHIWWXUQODQHDWWKH)URQWDJH5RDGLQWHUVHFWLRQZLWK:RRGGDOH $YHQXHDQGDFFHVVWRWKHVRXWKVLWHSURYLGHGE\ERWKD5,52DFFHVVRQWK6WUHHWDQGDVLWH FRQQHFWLRQWRWK6WUHHW7KHWK6WUHHWFRQQHFWLRQDOORZVWUDIILFWRDFFHVVWK6WUHHWIURPWKH <RVHPLWH$YHQXHRUWKH;HQZRRG$YHQXHWUDIILFVLJQDO 7KHLQFUHDVHGGHYHORSPHQWWULSVDOORIZKLFKDUHVHUYHGZLWKWKHWK6WUHHWFRQQHFWLRQGRKDYHDQ LPSDFWRQWKHURDGZD\QHWZRUN+RZHYHUWKHRYHUDOOLQWHUVHFWLRQRSHUDWLRQVDUHVWLOODWD/26'RU EHWWHU7KHUHLVTXHXHLQJEHWZHHQLQWHUVHFWLRQVGXHWRFDSDFLW\FRQVWUDLQWVDQGWKHFORVHVSDFLQJRIWKH IRXULQWHUVHFWLRQVDORQJ:RRGGDOH$YHQXH :KLOHPRVWWUDIILFLVW\SLFDOO\DEOHWRFOHDUHDFKVLJQDOZLWKLQRQHF\FOHERWK7+H[LWUDPSVDUH H[FHSWLRQV7KHZHVWERXQG7+H[LWLQJOHIWWXUQLVDQH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDW FDQEORFNWKHPRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHLVUHWDLQHGRQWKHUDPS7KH HDVWERXQG7+UDPSLVDQRWKHUH[FHSWLRQZLWKGRZQVWUHDPTXHXLQJLVVXHVWKDWFDQEORFNWKHULJKWWXUQ PRYHPHQWRQWR:RRGGDOH$YHQXH WKHUHVXOWDQWTXHXHFDQVSLOORXWWR7+DORQJWKHUDPS :LWKWZRRSWLRQVWRH[LWWKHVRXWKGHYHORSPHQWVLWHPRUHWUDIILFH[LWLQJWKLVVLWHFDQDFFHVVWKHURDGZD\ QHWZRUNIURP;HQZRRG$YHQXH7KLVDOOHYLDWHVWKHGHPDQGDWWKH5,52DFFHVV+RZHYHUZLWKDOORI WKHGHYHORSPHQWWUDIILFHQWHULQJWKHURDGZD\QHWZRUNWKHOLPLWHGFDSDFLW\DORQJ:RRGGDOH$YHQXH FDXVHVORQJHUTXHXHVWKDWDUHXQDEOHWREHFRQVLVWHQWO\VHUYHGLQRQHF\FOH7KHVHTXHXHVEXLOGDQG HYHQWXDOO\WKHWZRKHDYLHVWPRYHPHQWVGHYHORSVLJQLILFDQWTXHXHLQJSUREOHPV 7DEOHEHORZVXPPDUL]HVWKHUHVXOWVIURPWKH9,66,0DQDO\VLV PRUHGHWDLOHGUHVXOWVDUHVKRZQLQ $SSHQGL[7DEOH City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 143 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH Table 8: Scenario 3B – 2040 Base + PLACE Development Traffic with 35 th Street connection, PM Peak ,QWHUVHFWLRQ $SSURDFK 303HDN+RXU 'HOD\>VHFYHK@/26 /HIW 7KUX 5LJKW $SSURDFK ,QWHUVHFWLRQ :RRGGDOH$YHQXH# :%7+5DPS 1% $$ $ % 6%&$ & :%98.09 /F $ %60.2 /E :RRGGDOH$YHQXH# (%7+5DPS 1% % $ $ ' 6%&$ $ (%171.54 /F $199.21 /F 194.2 /F :RRGGDOH$YHQXH# )URQWDJH5RDG 1% $ $ $ % 6% '$$ $ (%44.92 /E 44.9 /E :%%% :RRGGDOH$YHQXH# 5DLO&URVVLQJ 1% % % 6% % % :RRGGDOH$YHQXH# WK6WUHHW 1% '63.45 /E $ & & 6%& %$ % (% '' $' :%& &&& WK6WUHHW# ;HQZRRG$YHQXH 1% ' & $ & ' 6% & &%& (%&%$% :%70.5 /E 85.31 /F 77.91 /E 84.3 /F WK6WUHHW# 3ODFH$FFHVV :%45.31 /E 45.3 /E 6%95.99 /F 96 /F City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 144 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH CONCLUSION 3/$&('HYHORSPHQWLVUHTXHVWLQJDSSURYDOWRFRQVWUXFWDSDUWPHQWXQLWVDURRPKRWHODQG DSSUR[LPDWHO\VTXDUHIHHWRIUHWDLODQGFRPPHUFLDOVSDFHDORQJ:RRGGDOH$YHQXH7KH GHYHORSPHQWWRWDOVDUHSURSRVHGWREHGLYLGHGEHWZHHQWKHQRUWKVLWHORFDWHGEHWZHHQ7+DQGWKH H[LVWLQJUDLOURDGDQGWKHVRXWKVLWHORFDWHGLQWKHQRUWKHDVWFRUQHURI:RRGGDOH$YHQXHDQGWK6WUHHW 7KHRYHUDOOWULSVHVWLPDWHGWREHJHQHUDWHGE\WKLVGHYHORSPHQWLQFOXGHVDSSUR[LPDWHO\WRWDOWULSV GXULQJWKH30SHDNKRXUDQGGDLO\WULSV7KHQRUWKVLWHWULSVZLOOKDYHOLPLWHGDFFHVVIURPWKH H[LVWLQJIURQWDJHURDGWKDWZLOOEHFRQYHUWHGWRDUHVWULFWHGDFFHVVLQWHUVHFWLRQDQGWKHUHIRUHWKH GHYHORSPHQWVL]HIRUWKHVLWHLVUHODWLYHO\VPDOOUHIOHFWLQJWKHWKUHVKROGWULSLQFUHDVHLGHQWLILHGWKURXJK SUHYLRXVZRUN 7KHVRXWKVLWHZLOOJHQHUDWHPRUHWULSVRQWKHURDGZD\QHWZRUN:LWKRQO\D5,52SURYLGLQJDFFHVVWR WKHVLWHLWZRXOGEHFRPHRYHUEXUGHQHGDVH[LWLQJWUDIILFZRXOGHQWHUWK6WUHHWLQWKHUHJXODUTXHXHRI YHKLFOHVPDNLQJWKHZHVWERXQGULJKWWXUQPRYHPHQWIURPWK6WUHHWWR:RRGGDOH$YHQXH$VWUDIILF DORQJWK6WUHHWEXLOGVWKHGHOD\VIRUWKHVLWHDFFHVVWRHQWHUWK6WUHHWFRXOGLQFUHDVHWRDOPRVWIRXU PLQXWHVSHUYHKLFOHZLWKQRWDOOYHKLFOHVEHLQJVHUYHGLQWKHSHDNKRXU$OVRWUDIILFHQWHULQJWKHVLWH FRXOGDFFHVVLWIURPZHVWERXQGWK6WUHHWZKLFKZRXOGFUHDWHPXFKORQJHUWUDYHOURXWHVDQGSRWHQWLDO8 WXUQVDORQJWK6WUHHW 7KHUHIRUHWKHFRQQHFWLRQWRWK6WUHHWVKRXOGEHFRQVWUXFWHGDVSDUWRIWKHUHGHYHORSPHQWRIWKH +&55$SDUFHO VRXWKVLWH LQRUGHUWRVHUYHWKHSURSRVHGGHYHORSPHQWGHPDQGVZLWKRXWFDXVLQJDQ XQGXHEXUGHQWRWK6WUHHW7KLVFRQQHFWLRQWRWK6WUHHWSURYLGHVGLUHFWDFFHVVWRWKHWUDIILFVLJQDODW WK6WUHHWDQG;HQZRRG$YHQXHDQGSURYLGHVGHYHORSPHQWWUDIILFZLWKFRQWUROOHGDFFHVVDQGJUHDWHU URXWHFKRLFHV,QDGGLWLRQWRWKLVFRQQHFWLRQWRWKVWUHHWLPSURYHPHQWVDUHUHFRPPHQGHGZLWKWKH SURSRVHG3/$&(GHYHORSPHQWSURMHFWXQGHUWKHSURSRVHGVWUHHWQHWZRUNDQGH[LVWLQJLQWHUFKDQJH FRQILJXUDWLRQDW:RRGGDOH$YHQXHDQG7+ • $OO6:/57%DVH,PSURYHPHQWVDVIROORZV − 7UDIILFVLJQDOVDWWKH7+UDPSWHUPLQDOLQWHUVHFWLRQVRQ:RRGGDOH$YHQXH − 5HVWULSH:RRGGDOH$YHQXHWRDODQHVHFWLRQ − 1HZVLJQDOV\VWHPDQGJDWHVIRUWKHIUHLJKWDQG/57FURVVLQJV − 1HZJUDGHVHSDUDWHGWUDLOFURVVLQJIRUWKH&HGDU/DNH/577UDLODW:RRGGDOH$YHQXH • &RQVWUXFWVRXWKERXQGOHIWWXUQODQHDWWKH632SURSRVHG5,52)URQWDJH5RDGLQWHUVHFWLRQZLWK :RRGGDOH$YHQXH • :LGHQLQJRIWKH:RRGGDOH$YHQXH%ULGJHDQGUHFRQILJXUDWLRQRIEULGJHFRUQHUVWRLPSURYHVLJKW GLVWDQFHDVLGHQWLILHGLQWKH0DUFK6(+0HPR:RRGGDOH$OWHUQDWLYHV$QDO\VLV±6WUXFWXUDO 2SWLRQV • &RQVWUXFW5,52DFFHVVWRWKHVRXWKVLWHDWWK6WUHHW • &RQVWUXFWHDVWERXQGOHIWWXUQODQHDW;HQZRRG$YHQXHWK6WUHHW IHHW 0DLQWDLQH[LVWLQJ QRUWKERXQGVRXWKERXQGDQGZHVWERXQGJHRPHWU\5HYLHZWKHLQWHUVHFWLRQJHRPHWU\DVSDUWRIDQ\ VSHFLILFUHGHYHORSPHQWSODQDQGRUVWUHHWLPSURYHPHQW • $GGIODVKLQJ\HOORZDUURZVLJQDOKHDGVIRUHDVWERXQGWK6WUHHWDW;HQZRRG$YHQXH • ,GHQWLI\WUDYHOGHPDQGPDQDJHPHQWVWUDWHJLHVIRUWKHVLWHLQFOXGLQJEXWQRWOLPLWHGWRUHGXFLQJWKH QXPEHURISDUNLQJVSDFHVDOORZHGIURPFXUUHQWFRGHUHTXLUHPHQWVDQGSURYLGLQJVHFXUHELF\FOH VWRUDJHIRUUHVLGHQWVDQGYLVLWRUV 2YHUDOOWKHSURSRVHGGHYHORSPHQWVFHQDULRZLWKWKHDERYHOLVWHGLPSURYHPHQWVVKRZVPLQLPDOLPSDFWWR WKHH[LVWLQJURDGZD\QHWZRUNXQGHUWUDIILFGHPDQG %\WKHLQFUHDVHLQEDFNJURXQGWUDIILFGHPDQGDVFXUUHQWO\IRUHFDVWHGFRPELQHGZLWKWKHSURSRVHG 3/$&(GHYHORSPHQWZRXOGUHDFKWKHFDSDFLW\RIERWKWKH:RRGGDOH$YHQXHDQGWK6WUHHWFRUULGRUV City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 145 3/$&('HYHORSPHQW7UDIILF,PSDFW6WXG\ -XQH 3DJH XQGHUWKHSURSRVHGVWUHHWQHWZRUNDQGH[LVWLQJLQWHUFKDQJHFRQILJXUDWLRQDW:RRGGDOH$YHQXHDQG7+ ,WLVUHFRPPHQGHGWKDWDVRWKHUVLWHVLQWKHDUHDDUHUHGHYHORSHGXSGDWHGWUDIILFFRXQWVEHREWDLQHGLQ SDUWLFXODUIROORZLQJWKHRSHQLQJRI/57DQGWKH7+SURMHFWVXFKWKDWWKHH[LVWLQJFRQGLWLRQPD\EH HVWDEOLVKHG)RUHFDVWVDQGRUWULSJHQHUDWLRQIRURWKHUGHYHORSPHQWVLQWKHDUHDVKRXOGEHDGGHGWRWKH QHZO\REWDLQHGH[LVWLQJYROXPHVDQGWKHRSHUDWLRQRIWKHVWUHHWQHWZRUNVKRXOGEHHYDOXDWHGWR GHWHUPLQHIXWXUHWUDQVSRUWDWLRQQHHGV $WWDFKPHQWV $SSHQGL[)LJXUH±3/$&(6RXWK6LWH3ODQ $SSHQGL[7DEOH±7ULS*HQHUDWLRQ7DEOH $SSHQGL[7DEOH±$OWHUQDWLYH6XPPDU\9,66,002(7DEOH $SSHQGL[7DEOHVWKURXJK±9,66,002(7DEOHV V ?SW?V?VWORX??SODQQLQJ?WUDIILFVWXG\?PHPR?XSGDWH?SODFHGHYHORSPHQWWLVWHFKPHPRGRF[ City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 146 W OODDALEAVESFFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BO H PB E -BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BO-B>>>>>>>>>>>>>>>>>>>>>>>lllllllllllllllllllllllllllllll> > > >FMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFMFOFO-BFO-BFO-BFO-BBE -B FO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BFO-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BE-BBUILDING CHOTELGROUNDFLOOR OPEN36TH ST WYOSEMITE AVE S35TH ST WNSHEET NUMBERDATENOSURVEYAPPROVEDDESIGNEDDRAWNPROJ. NO.WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISIONI HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORTAND THAT I AM A DULY LICENSEDUNDER THE LAWS OF THE STATE OFPRINT NAME:SIGNATURE:DATE:LIC. NO.REVISIONCHECKEDPlot Date: 05/09/2016 - 11:45amDrawing name: U:\193803195\CAD\Dwg\193803195 C1.01.DWGXrefs:, 193803195XSXV, 193803195BRDR, 193803195XSXT, 193803195XSNA, 193803195XSNO, XE2-GM01, 193803195XSNO4, 193803195XSNO2, 193803195XSNO3, 193803195 WOODDALE_Site, CAD-parcels, WB_MSR_south planTHE CONTRACTOR SHALL VERIFY AND BE RESPONSIBLE FOR ALL DIMENSIONS. DO NOT SCALE THEDRAWING - ANY ERRORS OR OMISSIONS SHALL BE REPORTED TO STANTEC WITHOUT DELAY.THE COPYRIGHTS TO ALL DESIGNS AND DRAWINGS ARE THE PROPERTY OF STANTEC. REPRODUCTIONOR USE FOR ANY PURPOSE OTHER THAN THAT AUTHORIZED BY STANTEC IS FORBIDDEN.PLACE6RXWK6LWH$SSHQGL[)LJXUHST. LOUIS PARK, MINNESOTA193803195C1.01CITY / COUNTY PARCELSPRELIMINARY SITE PLAN########################.################City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 147 Exhibit A1Trip Generation AssumptionsAMDATA PROVIDED INITIALLY BY PLACETOTALBuildingDevelopment Number Units Rate% Entering% ExitingNumber of Trips Entering Exiting TransitBike/ Walk Passby InternalNumber of Trips Entering ExitingNumber of Trips Entering ExitingA Apartments (mixed income) 70 Dwelling Units 0.51 20% 80% 36 7 29 15% 5% 0% 0% 20% 29 6 23 30% 25 5 20A Commercial/Retail (Maker space) 3 1000 Sq. Feet of Gross Leasable Area 1.08 61% 39% 3 2 1 0% 5% 5% 15% 25% 2 1 1 40% 2 1 1B Apartments (mixed income) 115 Dwelling Units 0.51 20% 80% 59 12 47 15% 5% 0% 0% 20% 47 9 38 30% 41 8 33Live/Work Type I 13 Dwelling Units 0.51 20% 80% 7 1 6 15% 5% 0% 0% 20% 5 1 4 30% 5 1 4Other Commercial/Retail (Bike Shop) 5.5 1000 Sq. Feet of Gross Floor Area 1.08 61% 39% 6 4 2 0% 25% 5% 5% 35% 4 2 2 30% 4 2 2N E-Generation Site 5 No. of Employees 0.40 90% 10% 2 2 0 0% 0% 0% 0% 0% 2 2 0 2 2 0113 28 850% 89 21 68 Subtotal North 79 19 60S Hotel 110 Total Rooms 0.53 59% 41% 58 34 24 5% 5% 0% 0% 10% 52 31 21 15% 50 30 20S Restaurant/Café 3.0 1000 Sq. Feet of Gross Floor Area 0.81 60% 40% 2 1 1 0% 0% 15% 10% 25% 2 1 1 20% 2 1 1Coffeehouse 1.5 1000 Sq. Feet of Gross Floor Area 108.4 51% 49% 163 83 80 0% 5% 15% 25% 45% 89 45 44 60% 65 33 32Commercial/Retail (Co-work) 3.616 1000 Sq. Feet of Gross Leasable Area 1.08 61% 39% 4 2 2 5% 5% 0% 10% 20% 3 2 1 30% 3 2 1C Live/Work Suites (both types) 102 Dwelling Units 0.51 61% 39% 52 32 20 15% 5% 0% 0% 20% 42 26 16 30% 36 22 14C Live/Work Type II Commercial Space 3 1000 Sq. Feet of Gross Floor Area 1.08 61% 39% 3 2 1 5% 5% 0% 10% 20% 3 2 130% 2 1 1*ITE Trip Generation 9th Edition282 154 128 0% 191 107 84 Subtotal South 158 89 69395 182 213 280 128 152 Total 237 108 12940% 41% 39% 29% 30% 29%PMDATA PROVIDED INITIALLY BY PLACETOTALBuildingDevelopment Number Units Rate% Entering% ExitingNumber of Trips Entering Exiting TransitBike/ Walk Passby InternalNumber of Trips Entering ExitingNumber of Trips Entering ExitingA Apartments (mixed income) 70 Dwelling Units 0.62 65% 35% 43 28 15 15% 5% 0% 0% 20% 35 23 12 30% 30 20 10A Commercial/Retail (Maker space) 3 1000 Sq. Feet of Gross Leasable Area 3.7 49% 51% 11 5 6 0% 5% 5% 15% 25% 8 4 4 40% 7 3 4B Apartments (mixed income) 115 Dwelling Units 0.62 65% 35% 71 46 25 15% 5% 0% 0% 20% 57 37 20 30% 50 33 17Live/Work Type I 13 Dwelling Units 0.62 65% 35% 8 5 3 15% 5% 0% 0% 20% 6 4 2 30% 6 4 2Other Commercial/Retail (Bike Shop) 5.5 1000 Sq. Feet of Gross Floor Area 3.7 49% 51% 20 10 10 0% 25% 5% 5% 35% 13 6 7 30% 14 7 7N E-Generation Site 5 No. of Employees 0.40 10% 90% 2 0 2 0% 0% 0% 0% 0% 2 0 2 2 0 2155 94 61 0% 12174 47 Subtotal North 109 67 42S Hotel 110 Total Rooms 0.60 51% 49% 66 34 32 5% 5% 0% 0% 10% 59 30 29 15% 56 29 27S Restaurant/Café 3.0 1000 Sq. Feet of Gross Floor Area 7.49 67% 33% 22 15 7 0% 0% 15% 10% 25% 17 11 6 20% 18 12 6Coffeehouse 1.5 1000 Sq. Feet of Gross Floor Area 40.75 50% 50% 61 31 30 0% 5% 15% 25% 45% 34 17 17 60% 24 12 12Commercial/Retail (Co-work) 3.616 1000 Sq. Feet of Gross Leasable Area 3.7 49% 51% 13 6 7 5% 5% 0% 10% 20% 11 5 6 30% 9 4 5C Live/Work Suites (both types) 102 Dwelling Units 0.62 65% 35% 63 41 22 15% 5% 0% 0% 20% 51 33 18 30% 44 29 15C Live/Work Type II Commercial Space 3 1000 Sq. Feet of Gross Floor Area 3.7 49% 51% 11 5 6 5% 5% 0% 10% 20% 9 4 5 30% 844*ITE Trip Generation 9th Edition236 132 104 0% 181 100 81 Subtotal South 159 90 69391 226 165 302 174 128 Total 268 157 11131% 31% 33% 23% 23% 22%DAILYTOTALBuildingDevelopment Number Units Rate% Entering% ExitingNumber of Trips Entering Exiting TransitBike/ Walk Passby InternalNumber of Trips Entering ExitingA Apartments (mixed income) 70 Dwelling Units 6.65 50% 50% 466 233 233 15% 5% 0% 0% 20% 372 186 186A Commercial/Retail (Maker space) 3 1000 Sq. Feet of Gross Leasable Area 44.32 50% 50% 133 67 66 0% 5% 5% 15% 25% 100 50 50B Apartments (mixed income) 115 Dwelling Units 6.65 50% 50% 765 383 382 15% 5% 0% 0% 20% 612 306 306Live/Work Type I 13 Dwelling Units 6.65 50% 50% 86 43 43 15% 5% 0% 0% 20% 69 35 34Other Commercial/Retail (Bike Shop) 5.5 1000 Sq. Feet of Gross Floor Area 44.32 50% 50% 244 122 122 0% 25% 5% 5% 35% 158 79 79N E-Generation Site 5 No. of Employees 2.00 50% 50% 10 5 5 0% 0% 0% 0% 0% 10 5 51704 853 851 0% 1321 661 660S Hotel 110 Total Rooms 8.17 50% 50% 899 450 449 5% 5% 0% 0% 10% 809 405 404S Restaurant/Café 3.01000 Sq. Feet of Gross Floor Area 89.95 50% 50% 270 135 135 0% 0% 15% 10% 25% 202 101 101Coffeehouse 1.5 1000 Sq. Feet of Gross Floor Area 310.5 50% 50% 466 233 233 0% 5% 15% 25% 45% 256 128 128Commercial/Retail (Co-work) 3.616 1000 Sq. Feet of Gross Leasable Area 44.32 50% 50% 160 80 80 5% 5% 0% 10% 20% 128 64 64C Live/Work Suites (both types) 102 Dwelling Units 6.65 50% 50% 678 339 339 15% 5% 0% 0% 20% 543 272 271C Live/Work Type II Commercial Space 3 1000 Sq. Feet of Gross Floor Area 44.32 50% 50% 133 67 66 5% 5% 0% 10% 20% 106 53 53*ITE Trip Generation 9th Edition2606 1304 1302 0% 2044 1023 10214310 2157 21533365 1684 1681Check Values22%22% 22%Apartment 300Retail/Commercial 19.6Hotel 110ITE Trip Generation Rate*Reduction % for Pass-by, internal capture, and modal cultureEstimated Trips (with Reductions)AM PeakAM PeakEstimated Trips (NO Reductions)AM PeakReductions SepartedEstimated Trips (with SEH Reductions)AM PeakITE Trip Generation Rate*DAILYEstimated Trips (NO Reductions)DAILYEstimated Trips (with SEH Reductions)DAILYReductions SepartedEstimated Trips (with Reductions)PM PeakPM PeakPM PeakPM PeakITE Trip Generation Rate* Estimated Trips (NO Reductions)Reductions SepartedEstimated Trips (with SEH Reductions)Reduction % for Pass-by, internal capture, and modal cultureCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 148 Appendix Table 2: 2020 and 2040 Intersection Peak Hour Delay and LOS Summary ,QWHUVHFWLRQ $OWHUQDWLYHV 'HOD\>VHFYHK@/26 $OWHUQDWLYHV 'HOD\>VHFYHK@/26 %DVH3/$&( 'HYHORSPHQW 3/$&('HY WK6W&RQQHFWLRQ%DVH3/$&( 'HYHORSPHQW 3/$&('HY WK6W&RQQHFWLRQ :RRGGDOH$YHQXH# :%7+5DPS % % % % % % :RRGGDOH$YHQXH# (%7+5DPS % % % & & ' :RRGGDOH$YHQXH# )URQWDJH5RDG $ $ $ $ $ % :RRGGDOH$YHQXH# WK6WUHHW % % % & & & WK6WUHHW# ;HQZRRG$YHQXH $ $ % $ & ' City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 149 $SSHQGL[7DEOHScenario 1A2020 Base ForecastPM Peak Hour (VISSIM)LRT Only/ 7 5 7RWDO / /26 7 /26 5 /26'HOD\ 69HK /26'HOD\ 69HK /26 6WRUDJH $YJ 0D[/LQN/HQJWK$YJ 0D[ 6WRUDJH $YJ 0D[1%:RRGGDOH $ $ $ $ 173 1766%:RRGGDOH $ % $ % % :%2II5DPS ) $ $ ' 1%:RRGGDOH $ $ $ $ 179 1576%:RRGGDOH % $ $ $ % 157 157(%2II5DPS ' $ & & 3971%:RRGGDOH $ $ $ $ 154 1446%:RRGGDOH & $ $ $ $ 141 138(%)URQWDJH $ $ & & :%)URQWDJH $ $ $ $ 1%:RRGGDOH $ $ $ $ 2476%:RRGGDOH $ $ $ $ 1851%:RRGGDOH ' ' $ % 91 6%:RRGGDOH % % $ % % 223 223 211(%WK & ' $ ' 172 224:%WK & ' % % 6671%;HQZRRG & & $ & 6%;HQZRRG & % $ & $ (%WK $ $ $ $ :%WK % $ $ $ /(*(1' ###4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH###4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJHWKDW;HQZRRGIntersectionApproach'HPDQG9ROXPHV 9HK+U :RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWK'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQ4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 150 $SSHQGL[7DEOHScenario 2A2020 Base + PLACE Development TrafficPM Peak Hour (VISSIM)LRT Only/ 7 5 7RWDO / /26 7 /26 5 /26'HOD\ 69HK /26'HOD\ 69HK /26 6WRUDJH $YJ 0D[/LQN/HQJWK$YJ 0D[ 6WRUDJH $YJ 0D[1%:RRGGDOH $ $ $ $ 175 1786%:RRGGDOH $ & $ % % :%2II5DPS ) $ $ ' 1%:RRGGDOH $ $ $ $ 183 1606%:RRGGDOH % $ $ $ % 133 133(%2II5DPS ' $ & & 4721%:RRGGDOH $ $ $ $ 169 1586%:RRGGDOH ' $ $ $ $ 93 146 154(%)URQWDJH $ $ & & :%)URQWDJH $ $ % % 1%:RRGGDOH $ $ $ $ 2546%:RRGGDOH $ $ $ $ 1841%:RRGGDOH ' ' $ % 6%:RRGGDOH % % $ % % 216 216 205(%WK ' ' % ' 212 220:%WK & & % % 731 731 8631%;HQZRRG & & $ & 6%;HQZRRG & ' $ & $ (%WK % $ $ $10 240 :%WK % $ $ $ :%WK $ $ & &6%$FFHVV $ $ ))/(*(1' ###4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH###4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJHIntersectionApproach'HPDQG9ROXPHV 9HK+U 4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQWKDW;HQZRRG:RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWKWKDW3ODFH$FFHVV'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 151 $SSHQGL[7DEOHScenario 3A2020 Base + PLACE Development Traffic with 35th Street connectionPM Peak Hour (VISSIM)LRT Only/ 7 5 7RWDO / /26 7 /26 5 /26'HOD\ 69HK /26'HOD\ 69HK /26 6WRUDJH $YJ 0D[/LQN/HQJWK$YJ 0D[ 6WRUDJH $YJ 0D[1%:RRGGDOH $ $ $ $ 174 1776%:RRGGDOH $ & $ & % :%2II5DPS ) $ $ ( 3371%:RRGGDOH $ $ $ $ 190 1676%:RRGGDOH % $ $ $ % 167 167(%2II5DPS ' $ ' ' 5691%:RRGGDOH $ $ $ $ 172 1626%:RRGGDOH ' $ $ $ $ 107 162 160(%)URQWDJH $ $ & & :%)URQWDJH $ $ % % 1%:RRGGDOH $ $ $ $ 2526%:RRGGDOH $ $ $ $ 1911%:RRGGDOH ' ( $ % 6%:RRGGDOH % % $ % % 223 223 212(%WK ' ' % ' 214 208:%WK & & % % 717 717152 8431%;HQZRRG & & $ & 6%;HQZRRG & & $ & % (%WK & $ $ $21 265 :%WK % % % % :%WK $ $ & &6%$FFHVV $ $ ( (/(*(1' ###4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH###4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJHIntersectionApproach'HPDQG9ROXPHV 9HK+U 'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQ4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQWKDW3ODFH$FFHVV:RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWKWKDW;HQZRRGCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 152 $SSHQGL[7DEOHScenario 1B2040 Base ForecastPM Peak Hour (VISSIM)LRT Only/ 7 5 7RWDO / /26 7 /26 5 /26'HOD\ 69HK /26'HOD\ 69HK /26 6WRUDJH $YJ 0D[/LQN/HQJWK$YJ 0D[ 6WRUDJH $YJ 0D[1%:RRGGDOH $ $ $ $ 178 1816%:RRGGDOH $ & $ & % :%2II5DPS ) $ % ' 3271%:RRGGDOH $ $ $ $ 186 1626%:RRGGDOH % $ $ $ & 170 170(%2II5DPS ) $ ) ) 1456407 14751%:RRGGDOH $ $ $ $ 169 1596%:RRGGDOH ' $ $ $ $ 153 167 165(%)URQWDJH $ $ ( ( :%)URQWDJH $ $ % % 1%:RRGGDOH $ $ $ $ 2506%:RRGGDOH $ % $ % 1891%:RRGGDOH ' ( $ & 6%:RRGGDOH % % $ % & 225 225 213(%WK ' ' % ' 226 260:%WK ' ' $ ' 1%;HQZRRG & $ $ & 6%;HQZRRG & % $ & $ (%WK $ $ $ $ :%WK % $ $ $ /(*(1' ###4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH###4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJH'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQ4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQWKDW;HQZRRGIntersectionApproach'HPDQG9ROXPHV 9HK+U :RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWKCity Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 153 $SSHQGL[7DEOHScenario 2B2040 Base + PLACE Development Traffic PM Peak Hour (VISSIM)LRT Only/757RWDO//267/265/26'HOD\ 69HK /26'HOD\ 69HK /266WRUDJH$YJ0D[/LQN/HQJWK$YJ0D[6WRUDJH$YJ0D[1%:RRGGDOH $$$$ 1751786%:RRGGDOH $&$&% :%2II5DPS )$%'1%:RRGGDOH $ $$$1831596%:RRGGDOH&$$$&165165(%2II5DPS)$ ) )126440012821%:RRGGDOH $$$$ 174 1646%:RRGGDOH '$$$$120 172170(%)URQWDJH $$'':%)URQWDJH$$ % % 1%:RRGGDOH $ $$ $2576%:RRGGDOH$%$% 1911%:RRGGDOH'($& 6%:RRGGDOH %% $%&222222210(%WK'' %'273255:%WK & &%&8588583008991%;HQZRRG& &$ &6%;HQZRRG&&%&&(%WK &$$ $19318:%WK ''''1373:%WK$$((6%$FFHVV$$))/(*(1' ### 4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH ### 4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJHWKDW3ODFH$FFHVV'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQ4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQWKDW;HQZRRG:RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWKIntersectionApproach'HPDQG9ROXPHV 9HK+U City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 154 $SSHQGL[7DEOHScenario 3B2040 Base + PLACE Development Traffic with 35th Street connectionPM Peak Hour (VISSIM)LRT Only/ 7 5 7RWDO / /26 7 /26 5 /26'HOD\ 69HK /26'HOD\ 69HK /26 6WRUDJH $YJ 0D[/LQN/HQJWK$YJ 0D[ 6WRUDJH $YJ 0D[1%:RRGGDOH $ $ $ $ 178 1826%:RRGGDOH $ & $ & % :%2II5DPS ) $ % ( 3621%:RRGGDOH $ % $ $ 185 1616%:RRGGDOH & $ $ $ ' 169 169(%2II5DPS ) $ ) )1029 27021047 27211%:RRGGDOH $ $ $ $ 171 1606%:RRGGDOH ' $ $ $ % 132 167 164(%)URQWDJH $ $ ( ( :%)URQWDJH $ $ % % 1%:RRGGDOH $ % $ % 2566%:RRGGDOH $ % $ % 1911%:RRGGDOH ' ( $ & 6%:RRGGDOH & % $ % & 224 224 212(%WK ' ' $ ' 248 246:%WK & & & & 891 891379 9191%;HQZRRG ' & $ & 6%;HQZRRG & & % & ' 130(%WK & % $ %35 367 :%WK ( ) ( ) 1624:%WK $ $ ( (6%$FFHVV $ $ ) )/(*(1' ###4XHXHOHQJWKDWRUDERYHRIWKHDYDLODEOHVWRUDJH###4XHXHOHQJWKDWRUDERYHDYDLODEOH6WRUDJHWKDW3ODFH$FFHVV:RRGGDOHDW1RUWK5DPS:RRGGDOHDW6RXWK5DPS:RRGGDOHDW)URQWDJH:RRGGDOHDW5DLO&URVVLQJ:RRGGDOHDWWKWKDW;HQZRRG'HOD\ 69HK /26%\$SSURDFK/26%\,QWHUVHFWLRQ4XHXH IHHW /HIW7XUQ7KURXJK5LJKW7XUQIntersectionApproach'HPDQG9ROXPHV 9HK+U City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUDPage 155 Revised PLACE Development 02.17.17 Number Units Enter Exit Total Enter Exit Total 220 Apartments 218 Units 20% 1,160 17 72 89 70 38 108 826 Commercial/Retail 5.1 K sq ft 30% 161 2 1 3 6 7 13 E. Generation Site 5employees0% 10202022 1,331 21 73 94 76 47 123 220 Apartments 81 units 20% 431 20 13 33 26 14 40 110 Hotel 110 total rooms 10% 809 31 21 52 30 29 59 931 Restaurant/Café 4.6 K sq ft 25% 313 2 1 3 17 9 26 936 Coffeehouse 1.2 K sq ft 45% 200 36 34 70 13 13 26 826 Commercial/Retail 3.986 K sq ft 20% 142 2 2 4 6 6 12 1,895 91 71 162 92 71 163 3,226 112 144 256 168 118 286 Dwellings 299 Commercial/Retail KSF 14.9 PLACE Development 06.14.17 Number Units Enter Exit Total Enter Exit Total 220 Apartments 198 Units 20% 1053 16 65 81 64 34 98 826 Commercial/Retail 8.5 K sq ft 30% 258 3 3 6 10 11 21 E. Generation Site 5employees0% 10202022 1321 21 68 89 74 47 121 220 Apartments 102 units 20% 543 26 16 42 33 18 51 110 Hotel 110 total rooms 10% 809 31 21 52 30 29 59 931 Restaurant/Café 3 K sq ft 25% 202 1 1 2 11 6 17 936 Coffeehouse 1.5 K sq ft 45% 256 45 44 89 17 17 34 826 Commercial/Retail 6.616 K sq ft 20% 234 4 2 6 9 11 20 2,044 107 84 191 100 81 181 3,365 128 152 280 174 128 302 Dwellings 300 Commercial/Retail KSF 19.6 AM Peak PM Peak North Site Totals South Site Totals Place Development Totals South Site Totals Place Development Totals Daily Total ITE Code Development Trip Reductions Daily Total ITE Code Development AM Peak PM PeakTrip Reductions North Site Totals City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 156 St. Louis Park – PLACE December 8, 2016 Ms. Jennifer Monson, AICP Planner City of St. Louis Park 5005 Minnetonka Blvd. St. Louis Park, MN 55416 Re: PLACE Parking Plan St. Louis Park, MN Dear Jennifer: Thank you for the opportunity to have Walker Parking Consultants perform a peer review of the proposed PLACE development at Wooddale Ave. S. and W. 36th St., in St. Louis Park. Our scope of work includes a review of the developer’s parking projections with a comparison to Walker’s recommendations in a Transit Oriented Development (TOD). We will also review the developer’s parking management plan for transportation demand and provide a summary of our assessment. PLACE-PROVIDED DATA The developer (PLACE) is planning two buildings with 300 residential units, a 110 room hotel, retail space including a bike shop, maker’s space, co-working space, café, and coffee house with 443 proposed parking spaces. They also are proposing an urban forest along the bike trail, as well as a greenhouse and an e-Generation station to supply alternative energy to the project. PLACE development has based the required parking needs on the attached Table-1 which was taken from their mobility plan. They have estimated their peak parking needs to be 428 spaces between 5 pm and 9 pm. This is allowing for one space per apartment, while removing 90 spaces for the “car-free living household” contracts that PLACE has included in their proposal. This also assumes 30% vacancy for the hotel patrons, no hotel employee parking, and a 50% vacancy for the retail parking requirements. There are many incentives to lower car dependency in their plan including: car share, bike share, hired driver services, a hotel shuttle, and the coming light rail station (with a residential shuttle until the station is in service). 1660 South Highway 100, Suite 545 Minneapolis, MN 55416 Office: 952.595.9116 Fax: 888.502.5726 www.walkerparking.com City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 157 St. Louis Park – PLACE Review December 8, 2016 Page 2 Table 1: PLACE Parking Table ST. LOUIS PARK-PROVIDED DATA St. Louis Park Planning (SLP) has provided the attached Table-2 with its estimated parking requirements. SLP has separated the total residential unit count into the individual unit bedroom counts. This allows for a more precise estimate of parking requirements per the City’s Code. The estimated parking requirements per city code totals 838. The proposed 443 spaces planned is only 53% of this requirement. The St. Louis Park City Code requirements can be found at: https://www.stlouispark.org/webfiles/file/zoning-code/Zoning-Code- 20161007/article_v_special_provisions_(updated_12-15).pdf When considering the shared use and mobility plan that PLACE has proposed, the SLP adjusted parking needs are indicated to be 542 spaces. The proposed parking of 443 spaces is only 82% of the SLP-adjusted estimate of 542 spaces. The City is allowing in their discounted estimate one parking space per one bedroom/studio units, and two parking spaces for 2+ bedroom units. This differs from the code requirement which is one space per bedroom. Also, considering 45 1-bedroom and 45 2-bedroom units are designated as “Car-Free Living Households”, the City estimates that the required spaces for residents is 307. Dwelling units Parking Spaces Needed Percent Vacated 9a-5p Parking Needs 9a-5p Percent Vacated 5p-9p Parking Needs 5p-9p Percent Vacated 9p-9a Parking Needs 9p-9a Affordable Residential 200 140 30%140 0%200 0%200 Affordable Visitors 20 20 25%15 0%20 0%20 Market-Rate Residential 100 100 40%60 0%100 0%100 Market-Rate Visitors 20 20 35%13 0%20 Hotel 110 110 42%63.8 30%77 32%74.8 Hotel Visitors 20 20 0%20 0%20 30%6 Café 1 50 0%50 50%25 100%0 Coffee House 1 50 0%50 50%25 100%0 Co-Working 1 20 0%20 50%10 100%0 Bike Shop 1 10 0%10 50%5 100%0 Maker Space 1 10 0%10 0%10 80%2 E-Generation 1 2 0%2 100%0 100%0 Car Sharing Vehicles 10 10 60%10 40%6 0%10 Car-Free Living Households 90 -90 -90 -90 -90 Total 472 373.8 428 322.8 SOURCE: PLACE Mobility Plan City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 158 St. Louis Park – PLACE Review December 8, 2016 Page 3 The City has provided data from area hotels indicating that a single parking space per room should be sufficient at a hotel located at this light rail station. Taking this into consideration, they estimate the total hotel spaces required is 110. The city also provided a local case study: The Hamline Station Apartments. This is a 108 unit, 178-bedroom mixed-use development with 13,000 sq. ft. of ground floor retail. With only 95 parking spaces, and nearly full occupancy of the rental units, there remain on average 25% of the parking spaces available. This is an excellent example of lower parking requirements in a mixed-use residential TOD location. Table 2: St. Louis Park Required Parking and Adjusted Estimate WALKER-PROVIDED DATA Utilizing the existing data without a market study, Walker’s shared parking model has produced the data presented in Table-3. The Walker model showed 10pm as the peak demand hour for both weekday and weekend. Walker entered the data as provided by SLP planning removing 30 of each 1 bed and 2 bed on the North Side and 15 of each 1 bed and 2 bed on the South Side dedicated as “car free” living spaces. With this data, it is evident that during the week, there are sufficient spaces, and on the weekend, the capacity is a 1 vehicle deficit. North Site Site Specifics SLP Parking Required Discounts Site Specifics 198 units 102 units 34 - Studios 1 per bed 34 1 per unit 34 28 - Studios 1 per bed 28 1 per unit 28 74 - 1 bed 1 per bed 74 74-30=44 units for car free living @ 1 per unit 44 22 - 1 bed 1 per bed 22 22-15=7 units for car free living @ 1 per unit 7 44 - 2 bed 1 per bed 88 44-30=14 units for car free living @ 2 per unit 28 26 - 2 bed 1 per bed 52 26-15=11 units for car free living @ 2 per unit 22 38 - 3 bed 1 per bed 114 2 spaces per unit 76 22 - 3 bed 1 per bed 66 2 spaces per unit 44 8 - 4 bed 1 per bed 32 2 spaces per unit 16 4 - 4 bed 1 per bed 16 2 spaces per unit 8 Total 342 198 Total 184 109 % discount for transit pass? % discount for transit pass on res. spaces? 1,500 sf bikeshop 1 per 250 6 % discount for shared parking?* 6 110 room hotel 1.5 per room 165 1 per room 110 3,000 makers space1 per 250 12 % discount for shared parking?*12 4,693 café 1 per 60 78 % discount for shared parking?*78 7,500 digester Per ZA 2 none 2 1,759 coffee 1 per 200 9 % discount for shared parking?* 9 10,000 greenhouse NA 0 none 0 3,000 coworking 1 per 400 8 % discount for shared parking?* 8 plus 5 car share spaces 5 plus 5 car share spaces 5 Total Req. North 394 with discounts 223 Total Req. South 444 319 Proposed Parking 182 182 Proposed Parking 261 261 Percent of Reqmt 46%82%Percent of Reqmt 59%82% Total Required 838 Adjusted Requirement 542 Total Proposed 443 Total Proposed 443 Percent of Reqmt 53%Percent of Reqmt 82% South Site SLP Parking Required Discounts SOURCE: St. Louis Park - Parking Analysis Worksheet City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 159 St. Louis Park – PLACE Review December 8, 2016 Page 4 Table-3: Walker Shared Parking Model Data Per City Code, further reductions may in some cases be available. Per the City’s Zoning Code Section 36-361: (d) Reductions. The following off-street parking reductions may be utilized jointly or separately except as indicated otherwise: (1) Transit Service. Parking may be reduced by 10 percent for any parcel located within one-quarter of a mile of a transit stop. To qualify, the transit stop must be served by regular transit service on all days of the week and adequate pedestrian access must be available between the transit stop and the parcel. Regular transit service shall operate at least twice hourly between 7:30 a.m. and 6:30 p.m. on weekdays and once hourly after 6:30 p.m. Regular transit service shall operate on Saturdays, Sundays, and holidays. Based on the above data, the City should allow an additional reduction. Transit Service is an additional 10% (or 54 spaces). The new adjusted requirement would be 488 spaces. Weekday 10pm Weekend 10pm North South Total North South Total Bike Shop 0 0 0 0 0 0 Coffee Shop 0 0 0 0 0 0 Café 0 0 0 0 0 0 Coworking and makers space 0 0 0 0 0 0 Residents 210 107 317 210 107 317 Resident Guests 15 15 30 30 15 45 Hotel 0 69 69 0 72 72 Hotel Employees 0 5 5 0 8 8 Total Parking Spaces Required 225 196 421 242 202 444 Planned Supply 182 261 443 182 261 443 Surplus (+)/Deficit (-)-43 65 22 -60 59 -1 SOURCE: Walker Parking Shared Parking Model City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 160 St. Louis Park – PLACE Review December 8, 2016 Page 5 Also in the City’s zoning code is a reference to Shared Parking: (f) Shared Parking. Shared off-street parking facilities are allowed to collectively provide parking in any district for more than one structure or use, subject to the following conditions: (1) The uses must have their highest peak demand for parking at substantially different times of the day or week, or an adequate amount of parking shall be available for both uses during shared hours of peak demand. A parking plan shall address the hours, size and mode of operation of the respective uses. (2) The minimum spaces required under a shared parking agreement shall be based on the number of spaces required for the use that requires the most parking. (3)Shared parking facilities shall be protected by an irrevocable covenant running with the land and recorded with the County in a form approved by the City Attorney. A certified copy of the recorded document shall be provided to the Zoning Administrator within 60 days after approval of the agreement by the City Council. Section 1 above states that the shared parking must have their highest peak demand at, “substantially different times of the day or week.” Per the PLACE provided model the hotel and the residential components both have their peak demand between 5pm and 9pm; therefore, this shared parking reduction does not apply to the largest demand segments. COMPARABLE CITY TRANSIT ORIENTED DEVELOPMENT DISCOUNTS Walker researched similar Transit Oriented Development (TOD) Zoning Codes as they apply to parking requirements at Light Rail Station Developments in other Cities. The cities were chosen because they have expanding Light Rail Systems, are in Northern Climates, and promote biking, car sharing, and other alternatives to vehicle ownership. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 161 St. Louis Park – PLACE Review December 8, 2016 Page 6 MINNEAPOLIS, MN Code of Ordinances 541.170 – Off-street parking requirements 1 space per Residential dwelling 1 space per 3 Hotel Rooms 1 per 500 sf Retail (bike shop) 1 per 500 sf coffee shop 1 per 500 sf up to 2000 then 1 per 300 sf Café 1 per 1,000 sf Office 50% reduction for 51 dwelling units or more in a TOD Zone Table 541-4.5 https://www.municode.com/library/mn/minneapolis/codes/code_of_ordinance s?nodeId=MICOOR_TIT20ZOCO_CH541OREPALO DENVER, CO Zoning – Off-Street requirements Sec. 59-316 1 space per studio/1 bedroom 1.5 spaces per 2 bedroom 2 spaces per 3+ bedroom 1 Space per Hotel Room 1 per 300 sf Retail, Coffee shop, and café 1 per 500 sf Office Per section 59-316 1.5) (a) Within a TOD District an area wide reduction of 25% in required spaces. (b) An additional 25% if served by more than 1 RTD Rail Line (c)An additional 25% if …trip reduction strategy… approved by city council and neighborhood organization (d) Maximum reduction shall not exceed more than 75%. https://www.denvergov.org/content/dam/denvergov/Portals/646/documents/Z oning/DZC/Former_Chapter_59/d15%20Mixed%20Use%20from%20Article%20IV%2 0Zone%20Districts%20of%20Former%20Chapter%2059_62510-4.pdf City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 162 St. Louis Park – PLACE Review December 8, 2016 Page 7 PORTLAND, OR Title 33, Planning and Zoning - Chapter 33.266.110 D. Minimum Transit Sites 1.Where there are 51 or more units, the minimum is 0.33 spaces per unit 2.All other uses. No parking is required for all the other uses. https://www.portlandoregon.gov/bps/article/53320 Based on the above criteria, the City of Minneapolis would require 363 spaces, but with the TOD reduction of 150 residential spaces, the total would be 213. The City of Denver would require 587 spaces, but with the TOD reductions of sections a) and c), of 50%, the total would be 294. The City of Portland would require 136 spaces for the Residential and Hotel only. In summary, all three cities TOD calculations come in below the 443 spaces requested by PLACE. ADDITIONAL DEVELOPMENT PROJECTS THE BROWNSTONE, ST. PAUL, MN Located along the Green Line in St. Paul, the Brownstone is an affordable, mixed-use development which broke ground on June 1, 2016. Although there are only 35 housing units, there is 20,000 sq. ft. of retail and office space, along with 7,000 sq. ft. of outdoor area dedicated to green space. There are 26 (.74 per unit) underground spaces reserved for residents, and 15 surface spaces for commercial use. 2700 UNIVERSITY, ST. PAUL, MN Also located along the Green Line in St. Paul, 2700 University is a Mixed-use development with 248 units and 3,000 sq. ft. of retail, a coffee house, outdoor living space, a self-serve bike repair area, and underground parking. 50 of the units will be dedicated to affordable housing based on 50% of AMI. There are 221 parking spaces which is less than 1 per unit. The current “Walkability” Score for the Elmwood Neighborhood (the proposed PLACE location) of St. Louis Park is currently a 51 which is considered “Somewhat Walkable”. This will surely increase once the Light Rail is functional and additional development is completed in the area. For example, the walkability score for the neighborhood surrounding The Brownstone is a 77 “Very Walkable” and the neighborhood surrounding 2700 University is a 72, also “Very Walkable”. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 163 St. Louis Park – PLACE Review December 8, 2016 Page 8 CONCLUSION The parking space requirements assume that the parking supply will all be reserved or time-limited to prevent unauthorized light rail parking. It should be noted as a concern that there will be no public light-rail parking associated with the construction of the new station. Also, during the winter months, some additional spaces may be lost due to snow coverage and plowed snow pile accumulation on the surface lot and on-street parking. The PLACE proposal has taken into consideration many aspects of, “Car-Free Living” and combined them into a centralized location at the future Light Rail Stop. However, given the aggressive nature of the project’s parking reductions and even with the agreement between PLACE and the hotel management firm to hire from the resident pool, the coming light rail station, the increased popularity of hired driver services, and the bike and car share availability; there is some risk that 443 spaces would not be sufficient. Based only on current on St. Louis Park zoning regulations, the City would not typically accept the proposal from PLACE as a satisfactory option for improved lifestyle and car- free living without revisions to parking supply or demand. The potential consequence is that there will be constrained parking at times, perhaps causing overflow to nearby areas, and causing dissatisfaction by affected patrons or neighbors. However, there is supporting evidence that if the City of St. Louis Park did approve the PLACE development, it could serve as a trial for future TOD Development. There have been multiple developments along the Green Line from Minneapolis to St. Paul to support that St. Louis Park could be successful with this development. With the caveats noted herein, and with all mitigations in place, the data compiled with the Walker Shared Parking Model suggest that the parking and development by PLACE could supply sufficient parking. Sincerely Yours, WALKER PARKING CONSULTANTS Geoff Posluszny Brian McGann Parking Consultant Parking Consultant City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 164 PLACE Parking Requirements PLACE: North Site Site Specifics SLP Parking Required Before Discounts Discount SLP Parking Required After Discounts Reductions 218 Dwelling Units 84 – Studios 1 per bed 84 1 per unit 84 0 74 – 1 bedrooms 1 per bed 74 74-35=39 units for car free living @ 1 per unit 39 -35 35 – 2 bedrooms 1 per bed 70 35-25=10 units for car free living @ 2 per unit 20 -50 23 – 3 bedrooms 1 per bed 69 2 spaces per unit 46 -23 2 – 4 bedrooms 1 per bed 8 2 spaces per unit 4 -4 Total 305 Total 193 -144 2,570 bikeshop 1 per 250 10.28 50% discount for rail/trail adjacency and shared parking 5.14 -5.14 2,529 makers space 1 per 250 10.12 100 % discount for shared parking 0 -10.12 7,500 digester Per ZA 2 none 2 0 2472 greenhouse NA 0 none 0 0 5 car share spaces 5 0 Total Required North 327.4 Total Required North with Discounts 205 -159 Proposed Parking 216 Proposed Parking 216 Percent of Requirement 66% Percent of Requirement 105% PLACE: South Site Site Specifics SLP Parking Required Before Discounts Discount SLP Parking Required After Discounts Reductions 81 Dwelling Units 48 – Studios 1 per bed 48 48-15=33 units for car free living @ 1 per unit 33 -15 16 – 1 bedrooms 1 per bed 16 16-5=11 units for car free living @ 1 per unit 11 -5 13 – 2 bedrooms 1 per bed 26 13-10=3 units for car free living @ 2 per unit 6 -20 4 – 3 bedrooms 1 per bed 12 2 spaces per unit 8 -4 0 – 4 bedrooms 1 per bed 0 2 spaces per unit 0 0 Total 102 Total 58 -44 110 room hotel 1.5 per room 165 1 per room 110 -55 4,644 café 1 per 60 77 25% discount for rail/trail/shared parking 57.75 -20 1,360 coffee 1 per 200 7 50% discount for rail/trail/shared parking 3.5 -3 3,854 co-working 1 per 400 10 25% discount for rail/trail/shared parking 7.2 -2 5 car share spaces 5 0 Total Required South 361 Total Required South 241 -124 Proposed Parking 231 Proposed Parking 231 Percent of Requirement 64% Percent of Requirement 96% Total Required 688 Total Required 447 Total Proposed 447 Total Proposed 447 Percent of Requirement 65% Percent of Requirement 100% City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 165 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSED UNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C101 SITE PLAN - OVERALL 0 80 160 N WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSED UNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DONOT scale the drawing - any errors or omissions shall be reported toStantec without delay.The Copyrights to all designs and drawings are the property ofStantec. Reproduction or use for any purpose other than thatauthorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C101 SITE PLAN - OVERALL 0 80 160 N PROOF OF PARKING B = 12-15 SPACES NORTH SIDE D = RAMP 55 SPACES PER LEVEL A = 20 SPACES NORTH & SOUTH SIDES E-GEN STRUCTURED PARKING ALTERNATIVE C = 40 SPACES City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 166 WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSED UNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DO NOT scale the drawing - any errors or omissions shall be reported to Stantec without delay. The Copyrights to all designs and drawings are the property of Stantec. Reproduction or use for any purpose other than that authorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C101 SITE PLAN - OVERALL 0 80 160 N WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT AND THAT I AM A DULY LICENSED UNDER THE LAWS OF THE STATE OF MINNESOTA. The Contractor shall verify and be responsible for all dimensions. DONOT scale the drawing - any errors or omissions shall be reported toStantec without delay.The Copyrights to all designs and drawings are the property ofStantec. Reproduction or use for any purpose other than thatauthorized by Stantec is forbidden. DescriptionNo.Date PRINT NAME: SIGNATURE: DATE LIC. NO. SUBMITTED FOR CITY APPROVALS FEB 6, 2017 C101 SITE PLAN - OVERALL 0 80 160 N PROOF OF PARKING B = 12-15 SPACES NORTH SIDE D = RAMP 55 SPACES PER LEVEL A = 20 SPACES NORTH & SOUTH SIDES E-GEN STRUCTURED PARKING ALTERNATIVE NOTE: Discussions with City Staff have identified a number of under-utilized surface parking lots in the area of the PLACE St. Louis Park project. One such potential location, adjacent to the Hoigaard’s Pond, is shown (C). C = 40 SPACES City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 167 PROOF OF PARKING - E-GEN SITE - STRUCTURED PARKING City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 168 Page 1 SLP MOBILITY PLAN At the heart of PLACE’s transit- oriented development (TOD) lies the opportunity to decrease dependence on the car. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 169 Page 2 SLP MOBILITY PLAN CAR-FREE LIVING PLACE will actively recruit forty households to sign a car-free living contract. SHARED BIKES PLACE will offer shared bikes on site for people who cannot afford to own their own bike CYCLING Cycling is a healthy form of mobility perfect for our site due to the Cedar Lake Trail system. LIGHT RAIL TRANSIT Light rail will provide a main feature of our transit- oriented development. Cars for hourly shared use will be provided in special hubs by HourCar and Car2Go. CARS Cars can be for personal use or for carpooling or part-time income from Uber-like service. SHUTTLE PLACE will operate a shuttle to take community members to key locations. BUS TRANSIT There are three bus stops within a quarter mile of the site. SHARED CARS PLACE St. Louis Park is a mixed-income, mixed-use, transit-oriented development aimed at residents seeking a more affordable and sustainable lifestyle. Strategy One is to reduce the need for mobility through smart location and design that places people where they want to be through the creation of on-site jobs, live/work space, art and culture, green space, and food production. Strategy Two is to provide a mix of mobility options that work for people of different ages, abilities and incomes and maximize family time. City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 170 CAR-FREE LIVING What does it mean to live car free? For some, it means poverty, disability or age. For an increasing number, it is a choice to ditch the cost and the hassle of personal car ownership. PLACE promotes car-free living because it impacts communities in so many positive ways, including: •Reduces traffic and vehicle miles traveled •Improves health •Makes for more affordable living •Lowers the carbon footprint of cities •Increases productive and family time For our PLACE St. Louis Park project, we will create a package of incentives to encourage people to choose alternatives to car ownership. Page 3 SLP MOBILITY PLAN | PLACE | 2016 “ ” MINNESOTANS NOW AVERAGE MORE VEHICLE MILES THAN MOST OF THE COUNTRY, MORE THAN EVEN CALIFORNIANS DRIVE. — TRANSPORTATION.GOV City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 171 STRATEGY ONE Reduce the baseline need for transportation within the community. LIVE/WORK SPACE When people have access to well-designed live/work space, there need for mobility goes down. One third of our apartments will be live/work suites. ON-SITE JOB CREATION PLACE St. Louis Park will create over one hundred jobs on site. Our hotel will have a preference for hiring from the community. Other jobs will be created in the cafe, coffee house, E-Generation and live/work space for creatives. MIXED-USE DEVELOPMENT Through a smart development mix, people can already be where they want to be, reducing the need to drive. Community members can walk to work, food, recreation, public space, and to experience art and culture. INTER-GENERATION LIVING People need to drive to visit family members less often when they can easily live in the same community without barriers to aging in place. Page 4 SLP MOBILITY PLAN | PLACE | 2016 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 172 PARKING IN A MIXED- USE DEVELOPMENT Mixed-use development allows residential parking to share parking with commercial. Page 8 SLP MOBILITY PLAN | PLACE | 2016 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 173 STRATEGY TWO Provide a mix of mobility options combined with a mix of incentives. MOBILITY OPTIONS •Bus •Light rail •Shared car •Cycling •Shuttle •Shared bike •Car service (Uber) INCENTIVES •Car-Free Perks Payment •Metro Pass •Shared Bike Access •Parking Savings •Car-ownership savings Page 5 SLP MOBILITY PLAN | PLACE | 2016 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 174 PARKING ENCOURAGES DRIVING There are 800 million parking spaces in America taking up over ten percent of our land. PLACE’s purpose in creating transit-oriented development is to significantly reduce traffic and dependence on the personal automobile. Getting people out of their cars has been shown to improve health, strengthen local economies, increase disposable income, increase public safety, and more. However, policies that increase parking—especially where parking is free —actually encourage more driving. In a 2016 study, McCahill et al demonstrated actual causality between the availability of parking and increased driving. Parking requirements make it much more difficult to encourage use of transit, walking, cycling and other alternatives to the car. PLACE will go further than any development yet to develop and incentivize alternatives to the car. We have an opportunity to truly change the habits of our community members if we are not forced to pay for and subsidize parking for the automobile. Please consider eliminating all minimum parking requirements, if not for all new developments, at least for PLACE as a pilot project. Page 9 SLP MOBILITY PLAN | PLACE | 2016 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 175 REFERENCES The following references are provided as support for our mobility assumptions. Page 6 SLP MOBILITY PLAN | PLACE | 2016 City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 176 PLACE - SUSTAINABILITY SOLAR SHADING STUDY March 21st September 21st December 21stJune 21st 9am 12pm 3pm N City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 177 PLACE - SUSTAINABILITY SOLAR SHADING STUDY All developments shall consider the effect of sun angles and shade patterns on other buildings. All new multiple-family and nonresidential buildings and additions thereto shall be located so that the structure does not cast a shadow that covers more than 50 percent of another building wall for a period greater than two hours between 9:00 a.m. and 3:00 p.m. for more than 60 days of the year. This section will not prohibit shading of buildings in an industrial use district, or as approved for buildings covered by the same PUD, CUP, or Special Permit. Shading of existing public spaces and outdoor employee break areas shall be minimized to the extent reasonable and possible. Proposed south residential building shades adjacent property west wall more than 50% from 1pm to 3pm from Sept 21st to March 21st which is a total of 180 days. March 21st September 21st December 21stJune 21st 1pm 3pm N City Council Meeting of April 17, 2017 (Item No. 8a) Title: PLACE – Comprehensive Plan 2030 Land Use Map Amendment; Preliminary and Final PUD Page 178 Meeting: City Council Meeting Date: April 17, 2017 Action Agenda Item: 8b EXECUTIVE SUMMARY TITLE: Excelsior & Monterey (Bridgewater Dominium Addition) Preliminary Plat and Preliminary PUD RECOMMENDED ACTION: Motion to Adopt Resolution denying rezoning to Planned Unit Development and denying preliminary plat with variances. POLICY CONSIDERATION: Does city council oppose this proposed redevelopment of the subject properties. SUMMARY: City Council met on April 3, 2017, to review the proposal described below. City Council approved a motion to direct staff to prepare a resolution and findings of fact supporting the denial of the Preliminary Plat with Variances and Preliminary Planned Unit Development for the proposed Excelsior & Monterey Development and Bridgewater Dominium Addition. The development proposal is for 148 residential units, 17,500 square feet for commercial, and three levels of structured parking under the building. The proposed housing included 8% of the units affordable at 50% of area median income (AMI). The building ranges from three to six stories tall, and with a rooftop trellis feature is over 75 feet in height at the highest point. The density of the development is 61.9 units per acre and exceeds the 50 units per acre generally allowed in the mixed use land use area. The site is located at 4424 and 4400 Excelsior Boulevard, and 3743 Monterey Drive. The applicant controls two of the 4 parcels, and the St. Louis Park Economic Development Authority owns the parcel at 3743 Monterey Drive. The development cannot proceed without Economic Development Authority support to sell its land. In addition, the developer applied for $4.5 million in tax increment financing assistance. FINANCIAL OR BUDGET CONSIDERATION: There are no financial impacts to denying the zoning applications. VISION CONSIDERATION: St. Louis Park is committed to promoting an integrating arts, culture and community aesthetics in all City initiatives, including implementation where appropriate. SUPPORTING DOCUMENTS: Resolution Prepared by: Sean Walther, Planning & Zoning Supervisor Reviewed by: Michele Schnitker, Deputy Community Development Director Approved by: Tom Harmening, City Manger City Council Meeting of April 17, 2017 (Item No. 8b) Page 2 Title: Excelsior & Monterey (Bridgewater Dominium Addition) Preliminary Plat and Preliminary PUD RESOLUTION NO. 17-_____ RESOLUTION ADOPTING FINDINGS AND DECISION DENYING REZONING TO PLANNED UNIT DEVELOPMENT AND DENYING PRELIMINARY PLAT WITH VARIANCES BE IT RESOLVED by the City Council of the City of St. Louis Park, Minnesota, that the following Findings and Decision are adopted: BACKGROUND 1.St. Louis Park Leased Housing Associates I, LLC has submitted an application for approval of a rezoning to Planned Unit Development (“PUD”) and a Plat with variances from the City’s subdivision requirements. 2.The Subject Property is located within the C-2 General Commercial and R-4 Multiple Family zoning districts. 3. Notice of the public hearing on the rezoning and preliminary plat with variances was mailed to all owners of property within 500 feet of the Subject Property. 4.Notice of the public hearings on the rezoning and preliminary plat was published in the St. Louis Park Sun Sailor. 5.The Planning Commission held the public hearing and recommended approval of the rezoning and preliminary plat with variances. 6.The City Council has considered the staff reports, Planning Commission minutes and recommendations, testimony of those appearing at the public hearings and comments in the record. FINDINGS OF FACT 1.The property is located at 4424 and 4400 Excelsior Boulevard and 3743 Monterey Drive, St. Louis Park, Minnesota (“Subject Property”). 2.The Property at 3743 Monterey Drive is owned by the St. Louis Park Economic Development Authority (“EDA”). The EDA did not sign or approve the applications for the rezoning, plat, and variances. The EDA does not support the applications and will not sell the property owned by it to the applicant. Without the property owned by the EDA, the plat cannot be approved or recorded and the project cannot be constructed. 3.The current zoning of the Subject Property is consistent with the City’s Comprehensive Plan and allows a reasonable use of the property. The current zoning of the Subject Property is supported by a rational basis related to the public health, safety, and welfare. City Council Meeting of April 17, 2017 (Item No. 8b) Page 3 Title: Excelsior & Monterey (Bridgewater Dominium Addition) Preliminary Plat and Preliminary PUD 4. The proposed development does not meet the purpose and intent of the PUD district which is to “promote higher standards of site and building design” and “encourage a more creative and efficient use of land.” The standards and building design of the proposed development are traditional and the use of the land is not creative. The scale of the development, in particular the combination of the proposed height and proposed footprint of the building is not sensitive enough to the adjacent uses and resulted in less area than desirable for site landscaping and at-grade amenities enjoyed by private residents and the public visiting and passing by the site. Also, the applicant failed to adequately demonstrate the turning movements for the proposed service area would be sufficient to handle maneuvering of service vehicles on-site and within existing access easements. The development plan does not justify an increase in the allowed residential density from 50 units per acre to 61.9 unit per acre and an increase in height from 75 feet to 76.5 feet. 5. Pursuant to the City Code, easements for utilities must be provided along all lot lines. The easements must be 10 feet wide along street right-of-ways and five feet wide along interior lot lines. The plat requires two variances from the required placement of drainage and utility easements. The plat proposes variances from five feet to zero feet along either side of the shared property line between Lots 1 and 2 of the proposed plat. In addition, variances are needed on Lot 1 from the 10-foot easement requirement down to approximately 9.5 feet along Monterey Drive in one isolated location near the proposed lobby, and down to between 7 and 9.5 feet for approximately 35 feet of the southeast corner of the proposed building along Excelsior Boulevard. 6. In considering the City Code provisions related to subdivision variances, the Council finds that: a. The requested variances do not relate to the nature of the proposed use of land and the existing use of land in the vicinity, the number of persons to reside or work in the proposed subdivision and the probable effect of the proposed subdivision upon traffic conditions in the vicinity. b. There are no special circumstances or conditions affecting the property such that the strict application of the provisions of the subdivision ordinance would deprive the applicant/owner of the reasonable use of the land. Encroachments into the proposed 10 feet wide easements along Excelsior Boulevard and Monterey Drive were avoidable by repositioning, or reducing the footprint of the proposed building or repositioning the building on the site. c. The requested variances would have no impact on the public health, safety and welfare of other property in the vicinity in which the property is situated. d. There is no topography, drainage or other naturally occurring characteristics of the land that result in an undue hardship preventing the land from being used in a manner typical of land within the vicinity. Although there are significant grade changes on the property, the site is a complete redevelopment of the lot which affords opportunities to avoid any variances or encroachments of the new site improvements into the required drainage and utility easements. e. The requested variances, considered by themselves, are not at odds with the intent of the Comprehensive Plan. City Council Meeting of April 17, 2017 (Item No. 8b) Page 4 Title: Excelsior & Monterey (Bridgewater Dominium Addition) Preliminary Plat and Preliminary PUD 7. The requirements for a variance are not satisfied because there is no unusual hardship. The Subject Property can be reasonably developed without at least two of the variances. 8. A plat must include the location, dimension, and purpose of all existing and proposed easements, both public and private, and utility easements intended to be dedicated or reserved for public use, including the size of such utility easements in acres. Without the requested variances, the Plat does not meet City Code requirements. DECISION Based upon the above findings, the materials submitted by the applicant, staff reports, submissions from the public and any other materials submitted to the City Council, the applications to rezone the Subject Property to PUD and for preliminary plat approval with variances are denied. Reviewed for Administration: Adopted by the City Council April 17, 2017 Tom Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk Meeting: City Council Meeting Date: April 24, 2017 Action Agenda Item: 8c EXECUTIVE SUMMARY TITLE: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions RECOMMENDED ACTION: Motion to Adopt Resolution rescinding Resolution No. 03-180 and approving the attached revised list of snow removal exempt parking areas. POLICY CONSIDERATION: This motion is allowed per the City’s established regulatory authority. SUMMARY: St. Louis Park's snow removal ordinance restricts on-street parking after a snowfall. The city, using a combination of available forecasts, will declare a snow emergency in advance of a storm where three inches of snow or more is forecasted. On-street parking is restricted during a snow emergency until streets are plowed from curb to curb and the snowfall has ended. There are some exceptions to the winter parking ordinance, where parking is limited due to nearby apartment buildings or commercial businesses. In these areas, parking is allowed within the first 24 hours of the snow emergency going into effect. After the first 24 hours, however, vehicles must be moved to a plowed street. Vehicles that aren't moved are subject to ticketing and towing. The streets adjacent to the Siena Apartment complex are not currently listed in the exception list. The city’s Traffic Committee is recommending adding the west side of Hampshire Avenue and the east side of Idaho Avenue to the exception list. A location map is attached. The attached resolution rescinds Resolution 03-180 and adopts a revised list of snow removal exempt areas (dated April 11, 2017) adding the west side of Hampshire Avenue and the east side of Idaho Avenue adjacent toe Siena Apartments. Also adding the segment of 31st Street between Glenhurst and the east city boundary. FINANCIAL OR BUDGET CONSIDERATION: The cost of modifying the parking restrictions will be minimal. Costs will come out of the general operating budget. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Exhibit 1: Proposed Additions Resolution Resolution 03-180 – To Be Rescinded Prepared by: Debra Heiser, Engineering Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 8c) Page 2 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions EXHIBIT 1: PROPOSED ADDITIONS Location Map: Proposed: Winter parking exception area Proposed: Winter parking exception area City Council Meeting of April 17, 2017 (Item No. 8c) Page 3 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions RESOLUTION NO. 17-___ RESOLUTION RESCINDING RESOLUTION NO. 03-180 AND EXEMPTING STREETS FROM THE SNOWFALL PARKING BAN TRAFFIC STUDY NO. 679 WHEREAS, the City of St. Louis Park, Minnesota established a list of streets exempt from the snowfall parking ban; and WHEREAS, the City of St. Louis Park, Minnesota has collected feedback from residents about modifying the list of exempt streets; and WHEREAS, the City of St. Louis Park, Minnesota has completed a full public process to inform interested parties about the Traffic Committee recommendation to modify the list of exempt streets. NOW THEREFORE BE IT RESOLVED by the City Council of the City of St. Louis Park, Minnesota, that the Engineering Director is hereby authorized to do the following: 1. Rescind Resolution 03-180. 2. Exempt the streets set forth on Exhibit L hereto and incorporated herein by reference, from the three (3) inch snowfall parking ban pursuant to Section 30-158 of the City Code. Reviewed for Administration: Adopted by the City Council April 3, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk City Council Meeting of April 17, 2017 (Item No. 8c) Page 4 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions EXHIBIT L Exempt Street Segments Street Name From To Side 14th Street Dakota Avenue Colorado Avenue South 16th Street Colorado Avenue Dakota Avenue North 16th Street Zarthan Avenue Park Place Blvd. Both 1st Street Gorham Avenue Republic Avenue Both 23rd Street Edgewood Avenue Florida Avenue Both 23rd Street Hwy. 100 Utica Avenue Both 25 1/2 Street E. Serv. Dr. Hwy. 100 26th Street Both 27th Street Louisiana Avenue Cul-de-sac Both 28th Street 4330 W. 28th Street 100 feet in length Both 28th Street Texas Avenue Virginia Avenue North 2nd Street Gorham Avenue Republic Avenue Both 30 1/2 Street Virginia Avenue Utah Avenue Both 30 1/2 Street Xylon Avenue Virginia Avenue Both 31st Street Inglewood Avenue East City Boundary Both 31st Street Xylon Avenue Virginia Avenue Both 32nd Street Xylon Avenue Virginia Avenue North 34th Street Lake Street 6216 W. 34th Street Both 35 1/2 Street Webster Avenue Yosemite Avenue Both 35th Street Alabama Avenue Zarthan Avenue North 35th Street Aquila Avenue Cul-de-sac Cul-de-sac Only 35th Street Beltline Blvd. Raleigh Avenue Both 35th Street Raleigh Avenue Cul-de-sac Both 35th Street Wooddale Avenue Alabama Avenue South 36 1/2 Street Kipling Avenue Excelsior Blvd. North 36 1/2 Street Lynn Avenue Kipling Avenue Both 36 1/2 Street Monterey Avenue Lynn Avenue Both 36th Street Huntington Avenue Cul-de-sac Both 36th Street Texas Avenue Independence Avenue Both 36th Street Wooddale Avenue Monterey Avenue Both 37th Street Aquila Avenue Target Parking Lot Both 37th Street Inglewood Avenue Joppa Avenue Both 37th Street Pennsylvania Avenue Walker Street Both 37th Street Texas Avenue Sumter Avenue Both 37th Street Wooddale Avenue Brunswick Avenue Both 39th Street Princeton Avenue Med Center Parking Lot Both Alabama Avenue 3463 Alabama Avenue 35th Street Both Alabama Avenue Excelsior Blvd. 400 ft N. of Excelsior Blvd. Both Aquila Avenue 34th Street Aquila Circle West Aquila Avenue 36th Street Hwy. 7 Both Aquila Circle Aquila Avenue Cul-de-sac Both City Council Meeting of April 17, 2017 (Item No. 8c) Page 5 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Auto Club Way Park Center Blvd. Med Center Parking Lot Both Beltline Blvd. Co. Road #25 36th Street Both Brookside Avenue Excelsior Blvd. 41st Street Both Brunswick Avenue Excelsior Blvd. Alley Entrance East Cambridge Street Edgewood Avenue RR Bridge Both Cedar Lake Road Hwy. 169 JCC Cul-de-sac Both Colorado Avenue 14th Street 16th Street Both Dakota Avenue 14th Street Cul-de-sac Cul-de-sac Only Dakota Avenue Lake Street RR Tracks Both Dakota Avenue Walker Street Dead End Both Dakota Avenue Walker Street N. Serv. Dr. Hwy. 7 Both E. Serv. Dr. Hwy. 100 Hwy. 100 25 1/2 Street Both E. Serv. Dr. Hwy 169 I-394 14th Street Both E. Serv. Dr. Hwy. 169 22nd Street 23rd Street Both Edgewood Avenue Cedar Lake Road Dead End Both Edgewood Avenue Oxford Street Cambridge Street Both Excelsior Blvd. France Avenue Meadowbrook Road Both Flag Avenue 36th Street Minnehaha Circle S. Both Florida Avenue 23rd Street Dead End Both Ford Lane Ford Road N. Serv. Dr. Hwy. 394 Both Ford Road Shelard Pkwy. N. Serv. Dr. Hwy. 394 Both France Avenue 40th Street Excelsior Blvd. West France Avenue Cedar Lake Avenue City Limits Both France Avenue Minnetonka Blvd. Cedar Lake Avenue West Gamble Drive Park Place Blvd. City Limit Both Gorham Avenue Louisiana Avenue Walker Street Both Hamilton Avenue Wooddale Avenue Brunswick Avenue South Hampshire Avenue 23rd Street 24th Street East Hampshire Avenue Cedar Lake Road 2012 Hampshire Ave West Hampshire Avenue S. Serv. Dr. Hwy. 7 Dead End Both Hampshire Avenue S.Serv. Dr. 394 Dead End Both Huntington Avenue 36th Street Excelsior Blvd. East Idaho Avenue Cedar Lake Road 2009 Idaho Avenue East Idaho Avenue 14th Street S. Serv. Dr. 394 Both Inglewood Avenue S. Serv. Dr. Hwy 25 31st Street Both Jersey Avenue 14th Street S. Serv. Dr. 394 Both Joppa Avenue Minnetonka Blvd.. N. Serv. Dr. Hwy. 25 Both Joppa Avenue Minnetonka Blvd. Sunset Blvd. East Joppa Avenue S. Serv. Dr. Co. #25 Dead End Both Jordan Avenue Cedar Lake Road 28th Street Both Lake Street Hwy. 7 Wooddale Avenue Both Lake Street S. Serv. Dr. Hwy. 7 Taft Avenue Both Lake Street 34th Street Brunswick Avenue South City Council Meeting of April 17, 2017 (Item No. 8c) Page 6 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Library Lane Lake Street Walker Street Both Louisiana Avenue Excelsior Blvd. Hwy. 394 Both Louisiana Ct. 28th Street Dead End Both Lynn Avenue 36th Street 36 1/2 Street West Lynn Avenue Minnetonka Blvd. N. Serv. Dr. Hwy 25 Both Lynn Avenue S. serv. Dr. Co. #25 Dead End Both Meadowbrook Blvd. Excelsior Blvd. Meadowbrook Lane Both Meadowbrook Lane Excelsior Blvd. Meadowbrook Blvd. Both Meadowbrook Lane Meadowbrook Blvd. Dead End Both Meadowbrook Road Excelsior Blvd. Oxford Street Both Med Center Blvd. Excelsior Blvd. Around Entire Loop Both Minnetonka Blvd. France Avenue Hwy. 169 Both Monitor Street S. Serv. Dr. Hwy. 7 Dead End Both N. Serv. Dr. Co. #25 Inglewood Avenue Joppa Avenue Both N. Serv. Dr. Co. #25 Ottawa Avenue Raleigh Avenue Both N. Serv. Dr. Hwy 25 Joppa Avenue Lynn Avenue North N. Serv. Dr. Hwy. 394 Shelard Pkwy. Ford Ln. Both N. Serv. Dr. Hwy. 7 Walker Street Wooddale Avenue Both Natchez Avenue Minnetonka Blvd. 3040 Natchez Avenue East Natchez Avenue S. Serv. Dr. 25 Dead End Both Nevada Avenue Cedar Lake Road Dead End East Nevada Avenue Cedar Lake Road 22nd Street Both Oak Leaf Drive Louisiana Avenue 2nd Street Both Oak Village Drive Louisiana Avenue Cul-de-sac Both Ottawa Avenue 31st Street N. Serv. Dr. Hwy 25 West Ottawa Avenue 39th St Excelsior Blvd. Both Ottawa Avenue Minnetonka Blvd. 3041 Ottawa Avenue East Oxford Street Alabama Avenue Zarthan Avenue South Oxford Street Meadowbrook Road Edgewood Avenue Both Park Center Blvd. 36th Street Excelsior Blvd. Both Park Glen Road Beltline Blvd. East Cul-du Sac Both Park Glen Road Beltline Blvd. West Cul-du Sac Both Park Place Blvd. Cedar Lake Road Hwy. 394 Both Parkdale Drive Park Place Blvd. Hwy. 100 Both Pennsylvania Avenue 14th Street 13 1/2 Street East Phillips Pkwy. 36th Street Cul-de-sac Both Powell Road Excelsior Blvd. Meadowbrook Road Both Princeton Avenue 39th St Excelsior Blvd. Both Quentin Avenue 39th St Excelsior Blvd. Both Quentin Avenue Cedar Lake Road City Limit Both Raleigh Avenue 35th Street 36th Street Both Raleigh Avenue Minnetonka Blvd. N. Serv. Dr. Hwy 25 West Republic Avenue 2nd Street Walker Street Both City Council Meeting of April 17, 2017 (Item No. 8c) Page 7 Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Rhode Island Avenue 28th Street Dead End Both S. Serv. Dr. Co. #25 France Avenue Beltline Blvd. Both S. Serv. Dr. Co. #25 Beltline Blvd. Cul-de-sac Both S. Serv. Dr. Hwy. 25 Lynn Avenue Joppa Avenue South S. Serv. Dr. Hwy. 394 City Limit Cul-de-sac Both S. Serv. Dr. Hwy. 394 Independence Avenue Shelard Pkwy. Both S. Serv. Dr. Hwy. 394 Park Place Blvd. City Limit Both S. Serv. Dr. Hwy. 7 Sumter Avenue City Limits Both S. Serv. Dr. Hwy. 7 Wooddale Avenue East to Cul-de-sac Both S. Serv. Dr. Hwy. 7 Wooddale Avenue Oregon Avenue Both Shelard Pkwy. S. Serv. Dr. Hwy. 394 Hwy. 169 Both Stephens Drive W. Serv. Dr. Hwy. 100 Dead End Both Sunset Blvd. Joppa Avenue Inglewood Avenue South Texas Avenue S. Serv. Dr. Hwy. 7 36th Street Both Utica Avenue 23rd Street Stephens Drive Both Virginia Avenue 26th Street 28th Street Both Virginia Avenue 30 1/2 Street 32nd Street Both Virginia Avenue 32nd Street Cul-de-sac West W.Serv. Dr. Hwy. 100 Minnetonka Blvd. Webster Avenue Both W. Serv. Dr. Hwy. 100 Stephens Drive 27th Street Both Walker Street Pennsylvania Avenue Dakota Avenue Both Webster Avenue 35 1/2 Street 36th Street Both Wooddale Avenue Excelsior Blvd. Toledo Avenue Both Wooddale Avenue Hwy. 7 Hwy. 100 Both Wyoming Avenue Minnetonka Blvd. 2948 Wyoming Avenue West Xenwood Avenue 36th Street North to Dead End Both Xenwood Avenue 36th Street South to Alley Both Xylon Avenue Minnetonka Blvd. 32nd Street East Yosemite Avenue 35 1/2 Street 36th Street Both Zarthan Avenue Cedar Lake Road S. Serv. Dr. Hwy. 394 Both City Council Meeting of April 17, 2017 (Item No. 8c) Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Page 8 City Council Meeting of April 17, 2017 (Item No. 8c) Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Page 9 City Council Meeting of April 17, 2017 (Item No. 8c) Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Page 10 City Council Meeting of April 17, 2017 (Item No. 8c) Title: Traffic Study No. 679: Snow Removal Exempt Parking List Revisions Page 11 Meeting: City Council Meeting Date: April 17, 2017 Action Agenda Item: 8d EXECUTIVE SUMMARY TITLE: Resolution Supporting Local Decision-Making Authority RECOMMENDED ACTION: Motion to Adopt Resolution supporting local decision-making authority. POLICY CONSIDERATION: Does the City Council wish to go on record in support of local units of government local decision-making authority and in opposition to legislative proposals to restrict or hinder local action. SUMMARY: The League of Minnesota Cities has drafted a model resolution for city councils concerned about the proliferation of 2017 legislative initiatives aimed at restricting local decision- making. This session, a significant number of bills are advancing in the House and Senate that interfere with local decision-making authority in several policy areas. Bills being considered would directly and indirectly hinder local decision-making across a broad range of policy and funding areas. Proposed legislation, for example, would have the effect of: • Constraining local law enforcement authority. • Restricting a city’s ability to set local ordinances. • Allowing certain businesses unfettered access to public rights of way while eliminating a city’s ability to manage them. • Restricting a city’s ability to use allowed fee structures. • Reducing local government aid (LGA) based on factors with no relation to the statutory LGA formula. • Restricting a city’s ability to study a light rail transit project. The attached resolution supports local decision-making authority and opposes legislation that removes the ability for local elected officials to respond to the needs of their businesses and constituents. If adopted it will be shared with our local legislators, the Governor, Speaker of the House, House Minority Leader, and the Senate Majority and Minority Leaders. FINANCIAL OR BUDGET CONSIDERATION: Not applicable. VISION CONSIDERATION: Not applicable. SUPPORTING DOCUMENTS: Draft Resolution LMC Fact Sheet List of 2017 Bills to Restrict Municipal Authority Prepared by: Kevin Locke, Community Development Director Approved by: Tom Harmening, City Manager City Council Meeting of April 17, 2017 (Item No. 8d) Page 2 Title: Resolution Supporting Local Decision-Making Authority RESOLUTION NO. 17-____ RESOLUTION SUPPORTING LOCAL DECISION-MAKING AUTHORITY WHEREAS, local elected decision-makers are in the best position to determine what health, safety and welfare regulations best serve their constituents; and WHEREAS, just like state legislative leaders, local elected officials are held accountable through Minnesota’s robust elections process; and WHEREAS, ordinances at the local level are enacted only after a comprehensive, legal and open process; and WHEREAS, local units of government are required to publish notices about meetings where policies will be discussed and decisions will be made; and WHEREAS, under the state’s Open Meeting Law, public policy discussions and decisions must occur in meetings that are accessible to members of the public; and WHEREAS, cities are often laboratories for determining public policy approaches to the challenges that face residents and businesses; and WHEREAS, preservation of local control in Minnesota has yielded statewide benefits such as the 2007 Freedom to Breathe Act, an amendment to the Minnesota Clean Indoor Air Act; and WHEREAS, more than two dozen bills that restrict local decision-making have been introduced in 2017 to date. NOW, THEREFORE, BE IT RESOLVED BY THE COUNCIL OF THE CITY OF ST. LOUIS PARK that this Council supports local decision-making authority and opposes legislation that removes the ability for local elected officials to respond to the needs of their businesses and constituents. Reviewed for Administration: Adopted by the City Council April 17, 2017 Thomas K. Harmening, City Manager Jake Spano, Mayor Attest: Melissa Kennedy, City Clerk wave of pre-emption legislation erodes local authority problem: Several bills introduced during the 2017 legislative session collectively serve to undermine Minnesota’s robust city-state partnership. This historic principle is based upon a shared vision and must allow communities and locally elected officials to tailor that vision to the unique needs of their citizens. Cities use a comprehensive, legal, and open process to develop ordinances. Through this process they often serve as laboratories for public policy. Obstructing this authority will impede innovation that has proven to result in statewide benefits. ©2017 League of Minnesota Cities. All Rights Reserved. for more information: Anne Finn Intergovernmental Relations Asst. Director Phone: (651) 281-1263 Email: afinn@lmc.org DID YOU KNOW? To date, more than two dozen bills that restrict local decision-making—on issues ranging from prohibition of plastic bags to the authority to set a local minimum wage—have been introduced in 2017. background: The League has historically supported the principle of local control, and opposed threats to local control at federal and state levels. League legislative policy SD 2 states that “City government most directly impacts the lives of people and therefore, local units of government must have sufficient authority and flexibility to meet the challenges of governing and providing citizens with local services.” A core value of the League is that locally elected decision-makers are in the best position to determine what health, safety and welfare regulations best serve their constituents. league of minnesota citiescity issue fact sheet 2017 league-supported solution: •Reject legislation that erodes the fundamental principle of local control in cities across Minnesota. •Continue to actively work together and communicate about our communities in a way that respects the authority each form of government is given by voters. Gary Carlson Intergovernmental Relations Director Phone: (651) 281-1255 Email: gcarlson@lmc.org City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 3 1 2017 Bills to Restrict Municipal Authority (Updated 4-5-17) ISSUE HF SF CURRENT STATUS Local Government Finance Eliminates LGA for cities that meet definition of “sanctuary city” 1664 n/a House: Referred to Gov Ops; amended into HF 754 during Property Tax Division, laid over for possible inclusion No Senate version Eliminates LGA for cities that enact “sanctuary ordinances” n/a 881 No House version Senate: Introduced, referred to Taxes Reduces LGA for cities that contribute to a World Fair, eliminates LGA for cities that are sanctuary cities, and reduces aid to cities and counties operating unauthorized driver diversion programs 754 n/a House: World Fair and diversion provisions included in HF 4 (omnibus tax bill) No Senate version Eliminates LGA for cities with sick time laws and other local labor regulations 2107 2157 House: Heard in Property Tax Division, laid over for possible inclusion Senate: Referred to Taxes Reduces LGA for lobbying expenses of local units of government 2187 2155 House: Heard in Property Tax Division, laid over for possible inclusion Senate: Referred to Taxes Requires reverse referendum every five years to authorize municipality to impose franchise fees to raise revenue 1146 2092 House: Included as provision in HF 4 (omnibus tax bill) Senate: Heard in Local Gov, referred to Taxes Requires a reverse referendum for lease purchase of public buildings 112 1849 House: Included as provision in HF 4 (omnibus tax bill) Senate: Referred to Taxes Provides a delayed reverse referendum requirement on a general city (over 500) or county levy increase 654 1590 House: Included as provision in HF 4 (omnibus tax bill) Senate: Referred to Taxes City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 4 2 ISSUE HF SF CURRENT STATUS Creates special tax district to finance operating costs of light rail and bus rapid transit lines, and prohibits TIF districts from being created in the special taxing district for fixed guideway lines in operation or for which a locally preferred alternative has been designated, and no abatement of the incremental tax for the special taxing district may be made 1315 1825 House: Heard in Transportation Policy, referred to Transportation Finance Senate: Referred to Transportation Finance and Policy Repeals city authority to establish special service districts 2412 n/a House: Referred by Tax chair to Property Tax Division No Senate version Public Safety Prohibits law enforcement agencies from using unmanned aerial cameras to gather evidence in certain circumstances 1200 1529 House: Referred to Public Safety Senate: Referred to Public Safety Prohibits political subdivisions (and the State Building and Fire Code) from requiring installation of fire sprinklers in certain dwelling units 681 579 House: Included as provision in House version of SF 780 (omnibus agriculture finance bill; companion is HF 895) Senate: Included as provision in SF 780 (omnibus agriculture and housing appropriations bill) Requires law enforcement agencies to comply with federal immigration detainers 26 n/a House: Referred to Public Safety No Senate version Worker Benefits Prohibits cities from enacting local employer benefit or minimum wage requirements 600 580 House: Passed by House 76-53 Senate: On General Orders Prohibits local governments including cities, towns, counties, etc., from enacting their own minimum wage requirements 180 n/a House: Initially referred to Commerce, was re-referred to Jobs No Senate version City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 5 3 ISSUE HF SF CURRENT STATUS Administrative Issues Imposes new restrictions on interim ordinances related to housing 330 201 House: Passed by House 87-44; included in House version of SF 1937 (omnibus jobs, commerce, energy, labor and industry, and employment and economic development appropriations bill; companion is HF 2209) Senate: On General Orders Requires cities and counties to notify potentially impacted businesses of an ordinance that impacts a business licensed in the jurisdiction, including if the ordinance changes the location or availability of a product or service provided by the business 1242 1224 House: On General Register Senate: On General Orders Requires a minimum three-year data retention period for “correspondence”, and defines correspondence in government record retention law 1185 1719 House: Heard in Gov Ops, Civil Law, now in State Gov Senate: Referred to Judiciary Requires a local government's data retention schedules provides for at least 18 months of retention for electronic records from the date the record is created 70 123 House: Referred to Gov Ops Senate: Heard informationally in Judiciary Adds new notification requirements on counties and cities related to written procedures across the local governmental enterprise 61 n/a House: Referred to Gov Ops No Senate version Transportation Prohibits cities, counties, special taxing districts, and others from spending money on studying feasibility, planning, designing, engineering, etc. the development or operation of intercity or interregional passenger rail facilities or operations between the City of Rochester, 465 254 House: Included as provision in HF 4 (omnibus tax bill) Senate: Heard in Transportation, laid over for possible inclusion City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 6 4 ISSUE HF SF CURRENT STATUS or locations in the metro area, and any location in the metro area Prohibits regional rail authorities and metro counties and cities from spending any money to study, plan, design, or construct a light rail line, or expand an existing line, unless the legislature explicitly authorizes it 418 & 1866 150 House: Included as a provision in HF 861 (omnibus transportation bill) Senate: Heard in Local Gov, Transportation Finance and Policy, referred to Finance Prohibits political subdivisions from expending public sources of funds for a guideway project, whether for a new or extending line, including study, alternatives analysis, design, engineering, environmental analysis, land acquisition, purchasing rolling stock and other equipment, and construction 1630 n/a House: Part of bill is included as a provision in HF 861 (omnibus transportation bill) No Senate version Prohibits road authorities including cities from using funds that increase the cost for any aesthetic enhancements that increase the cost of a project on a highway or bridge, including monuments, markers, memorials, sculptures, statues, decorative fixtures, alternative materials, specialty signage and other treatments designed to impact the perceived beauty or visual appeal of the infrastructure 1062 n/a House: Referred to Transportation Policy No Senate version Housing Requires legislative approval of local housing goals that are currently negotiated between cities and the Metropolitan Council for the purpose of regional grant program funding 1037 n/a House: Included as a provision in House version of SF 1937 (omnibus jobs, commerce, energy, labor and industry, and employment and economic development appropriations bill; companion is HF 2209) No Senate version Solid Waste and Recycling Adds more requirements which erode a local government's ability to manage solid waste collection. 1976 1755 House: Referred to Gov Ops Senate: Referred to Local Gov City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 7 5 ISSUE HF SF CURRENT STATUS Prohibits local government from banning or taxing plastic bags. 1504 1195 House: Tax provision included in HF 4 (omnibus tax bill); policy language included as provision in House version of SF 1937 (omnibus jobs, commerce, energy, labor and industry, and employment and economic development appropriations bill; companion is HF 2209) Senate: Included as provision in Senate version of HF 888 (omnibus environment and natural resources finance; companion is SF 723) Regulatory Issues Prohibits cities from imposing municipal planning fees to review or investigate a permitted use for compliance with any official control, which are ordinances or regulations that control the physical development of a city etc., including ordinances establishing zoning, subdivision controls, site plan regulations, sanitary codes, building codes, and official maps 957 n/a House: Included as a provision in HF 4 (omnibus tax bill) No Senate version Allows for profit entities unregulated access to public right-of-way for installation of "small cell wireless" equipment, and supersedes many zoning ordinances and comprehensive plans in place 739 561 House: Heard in Commerce, Gov Ops, Jobs, laid over for possible inclusion Senate: Heard in Energy, referred to Local Gov City Council Meeting of April 17, 2017 (Item No. 8d) Title: Resolution Supporting Local Decision-Making Authority Page 8